KEGG   Clostridium sp. SY8519: CXIVA_01040Help
Entry
CXIVA_01040       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cls  Clostridium sp. SY8519
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cls00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cls00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96083..97543)
Genome map
AA seq 486 aa AA seqDB search
MKLSDLLERTAYTCVQGNPDTEVSAVVYDSRKVVPGAVFVCIPGAVRDGHEFGPAAAQQG
AAALVVEHKLDVPDVVQIQVEDARLALAELSAAYFGHPAEKLTTIGITGTKGKTTTTYMV
KNILESAGHKVGLIGTIETIIGEEHIPAVNTTPESYVVQESFAKMVEAGCDSVVMEVSSQ
GLMLHRVSGFVFDYGIFTNLEPDHIGPNEHKDMDDYIRCKGLLFQQCKVGILNGDDEHLE
QVLKGHTCTVETFGLRETDDFYARDLQLERRPGFLGIRYHVCGKMDFEVETDIPGRFSVY
NSLTAIAICYHFGVAPEQIQKSLAQVKVKGRVEIIPISDHYTLMIDYAHNAMALESLLTT
LREYHPKRLVCLFGCGGNRSKLRRYEMGEVSSRLADLTVVTSDNPRYEEPDAIIDDIITG
VKKAPGEYVRITDRKEAIRYCMVNAREGDVIVLAGKGHEDYQEIKGQKHHMDERELIAQI
RQEEGI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatctgatttactagagcggacagcgtatacatgtgtgcagggaaatccggat
acagaagtatccgcggttgtatacgattccagaaaagttgtgcctggagcagtctttgtg
tgcatcccgggtgctgtcagggacggacatgaatttggcccggcagcagcgcagcagggc
gcggcggcactggtcgtggaacataagctggacgtaccggatgtggtacagattcaggta
gaggatgcccgcctggcgctggcagagctgtctgccgcatatttcggccatccggcggaa
aagctgaccaccatcggaatcaccggcaccaaaggcaagaccaccacgacttatatggtg
aaaaacatcctggagagcgccggccataaagtcgggctgatcggtaccattgagacgatc
atcggagaggaacatattcctgcggtcaatactacaccggagtcctatgtggtgcaggaa
tcctttgccaaaatggtggaagccggctgcgacagcgtggtcatggaagtttcttcccag
ggactgatgctgcaccgggtatccgggtttgtgtttgattacggtatttttaccaatctg
gagccggatcacatcggaccgaatgagcataaggacatggatgactacattcgctgcaaa
ggcctgctgttccagcagtgcaaagtcggtatcctgaatggggacgatgaacatctggaa
caggttctgaaaggccatacctgcaccgtggagaccttcggcctgcgggaaacagatgat
ttctatgccagagacctgcagctggagcgcagaccgggatttctgggcatccggtaccat
gtctgcggaaaaatggattttgaggtggaaacggatattccgggcagattttcggtatac
aattcactgaccgccattgccatctgttatcatttcggcgtggcgccggagcagattcag
aaatctctggcacaggtcaaagtaaaaggccgagtggagattattccgatttccgaccac
tataccctgatgatcgattatgcccacaatgcgatggcgctggaaagccttctgactacc
ctgcgggagtatcatccgaaacggctggtctgcctgtttggctgcggcggcaaccgttcc
aaactgcgccgttatgagatgggagaagtatcttcccgtttggcggatctgaccgtcgtt
acttcagacaatccgcgttatgaagaaccggacgcgattattgatgatattatcaccgga
gtgaagaaagcgccgggagaatatgtccgtatcacagaccggaaggaagcgatccgctac
tgcatggtaaatgcccgggagggcgacgtgattgtcctggcaggcaagggccatgaagat
tatcaggagatcaaagggcagaagcatcatatggatgagcgggagctgattgcgcagatt
cgtcaggaagaggggatctga

DBGET integrated database retrieval system