KEGG   Clostridium sp. SY8519: CXIVA_02230Help
Entry
CXIVA_02230       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cls  Clostridium sp. SY8519
Pathway
cls03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cls00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CXIVA_02230
Enzymes [BR:cls01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CXIVA_02230
DNA repair and recombination proteins [BR:cls03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CXIVA_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD HHH_5 PIF1 T2SSE UvrD-helicase NTPase_1 AAA_16 RsgA_GTPase UvrD_C HHH_2 DUF2075 AAA_28 AAA_22 PhoH Thymidylate_kin AAA ABC_tran ATP-synt_ab Zeta_toxin AAA_23 cobW DUF4444 TrwB_AAD_bind AAA_29 AAA_12
Motif
Other DBs
NCBI-ProteinID: BAK46190
UniProt: F7V7T0
Position
complement(211172..213460)
Genome map
AA seq 762 aa AA seqDB search
MEEIRGYVDHIIFRNQENGYTVLNLISDGEEQTCVGTFPSVDEGMSMVARGEYTTHPSYG
QQFRIREYEETMLQDAVSAERYLSSGAIRGIGAALAARIVKRFGEDTFRIIEEEPERLAE
IKGISERKAREIAEQVSRKREMRSAMMYLQKYGIAMNLAVKIYQTYGAELYDMIRTNPYK
LADDMTGVGFRTADEIARRAGIHRDSDFRIRSGILYMLQQAALQGNTCLPARMLTEQTAQ
MLEVDEEAVRRHYMDLAIDRKVVLKETEKDLWVYATAYYYMEENTAYMLGQLNAEYDVPE
REIEEQVRKIEKESGLEPEERQMEAVKAAIRNGLLVITGGPGTGKTTIINMILRYFDQEG
CDILLAAPTGRAAKRMSEATGYEAKTIHRMLELSGGIEGNAGFERNAENPLEADVIIIDE
MSMVDISLMYALLKAVLPGTRLILVGDINQLPSVGPGTVLKDIIDSGICHTVRLNRIFRQ
ASSSDIIVNAHRINAGEAITVNNKSRDFFFLKRYDANEIIGLCIKLIRDSLPKYIQADSR
EIQLLTPMRKGMLGVERLNKIMQQYLNPPDPSRAERQQGSDLFREGDKVMQIRNNYQLEW
TVSSKYGIPIDRGVGVFNGDTGVIRCIDEFSQTVTVEYEDRRKVDYEFGQLDELELAYAV
TIHKSQGSEYPAVVIPLLSGPRMLMNRNLLYTAVTRAKNCVVLVGDEQVFQGMIANASEQ
KRYSGLLSRLKEEMHEGENPMEKWSSCPDGAETADWPERADS
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatccgcggatatgtggaccatatcatattcagaaatcaggaaaacggatat
accgtactgaatctgatcagtgacggggaagaacagacctgtgtcggcaccttcccttct
gtggatgaggggatgagcatggtggcccggggagagtacacgacacatccctcttacggg
cagcagttccggattcgtgagtatgaagaaaccatgcttcaggacgcggtttctgcagaa
cggtatctgagttccggggcgatccgcggaatcggcgcggcactggcggcacgtatcgta
aaacgcttcggcgaggatacctttcgcatcatcgaggaggaaccggaacgcctggcagag
atcaagggaatcagtgaacgtaaggccagggagattgctgagcaggtttcccggaaacgg
gagatgcgcagcgcgatgatgtatctgcagaagtacgggatcgccatgaacctggcagtg
aagatttatcagacctatggggcggagctgtatgatatgatccgcaccaatccttacaaa
ctggcagatgacatgaccggggtgggatttcgcacagcggacgaaatcgcgcgcagggcg
ggaatacaccgggattcggatttccggatccgaagcgggatcctttacatgctgcagcag
gccgctttgcagggaaatacctgcctgcctgcccgcatgctgaccgagcagacggcgcag
atgctggaagtggatgaagaggcggtccgccggcattatatggacctggcgattgaccga
aaggtggtcctgaaagaaacggagaaggatctgtgggtgtacgcgaccgcttactattac
atggaggaaaataccgcatatatgctggggcagctgaatgcggaatatgacgtaccggag
cgggagattgaagagcaggtacgaaaaatcgaaaaagaaagcggactggagccggaagag
agacagatggaagcagtcaaggcggcgatccggaacggcctccttgtgatcaccggcggt
cccggcaccggtaaaaccaccattattaacatgatccttcggtattttgaccaggaaggc
tgcgatatccttctggcagccccgaccggcagagcagccaagcgtatgagcgaggccaca
ggctacgaagcaaagaccattcaccggatgctggaactatccggtggaatcgagggaaat
gcggggtttgaacgaaatgcggagaacccgctggaggcggatgtcattattatcgacgag
atgtccatggtggatatttctctgatgtatgccctcctgaaggcggtgcttcccgggacg
cgtctgatccttgtgggagatattaatcagctgcccagcgtagggccgggaacggtgctg
aaggatattattgactccggaatctgccatacggtacggctgaaccggattttccgtcag
gcctccagcagtgatattattgtgaatgcccacaggatcaatgccggtgaggccattacg
gtaaacaacaaaagccgggactttttcttcctgaagcgttatgacgccaatgagatcatc
ggcctctgcattaagctgatccgcgacagcctgccgaagtacatccaggcggattccagg
gaaattcagctgctgacgcccatgcggaaaggaatgctgggcgtggaacgtctcaataaa
atcatgcagcagtatctgaatccgccggatccatccagggcagagcggcagcagggcagt
gatctgttccgggaaggggacaaggtcatgcagatccggaacaattatcagctggagtgg
acggtttccagcaaatacggcatccctattgaccggggtgtgggagtattcaacggagac
accggcgtgatccgctgcattgacgagttttcccagacggtgaccgtggagtatgaggac
cggcggaaagtggattatgaattcggacagctggatgagctggaactggcatacgcggtg
accattcacaagtcccagggatcggaatatccggcggtggtgatcccgctgctgagcggc
ccgcggatgctgatgaaccgcaacctgctctatacggccgttacaagagcgaaaaactgt
gtggtgctggtgggggatgaacaggtttttcagggaatgatcgcgaatgcaagcgaacag
aagcgttacagcggactgctcagcagactgaaggaggaaatgcatgagggggagaatccg
atggaaaaatggagcagctgtcccgacggggcagaaacggcggactggccggagcgtgct
gattcgtga

DBGET integrated database retrieval system