KEGG   Clostridium sp. SY8519: CXIVA_03780Help
Entry
CXIVA_03780       CDS       T01565                                 

Gene name
AsnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cls  Clostridium sp. SY8519
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CXIVA_03780 (AsnB)
Enzymes [BR:cls01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CXIVA_03780 (AsnB)
Peptidases [BR:cls01002]
 Cysteine Peptidases
  Family C44
   CXIVA_03780 (AsnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396605..398188
Genome map
AA seq 527 aa AA seqDB search
MCSIMGYMGSRMTAEEFADALAATTSRGPDATRITDIPNGYLGFNRLAIMGLTASGMQPF
TRNRNALVCNGEIFGFRPIKAQLEAEGCRFESDSDCEILLPMYEKLGTDMFSRLDGEFAL
IIYDADKDSLIAARDPMGIRPLYYCYDSDENIVFASEPKNLTKYFDRIMPFPPGYYYENG
EFICYRDMSESSFYSKDSMDEISRNIHDKLIAGVRKRMDSDTPVGFLLSGGLDSSLVCGI
AARDSSRPIRTFAIGMDTDAIDLKYAREVAEYIHSDHTEVIISAQDVIDALEPVIRILGT
YDITTIRASIGMYLVCKYIHEHTDIRVLLTGEISDELFGYKYTDFAPSPEAFQEEARKRI
HEIHMYDVLRADRCISSNSLEARVPFGDLDFVDYVMHIDPEIKMNHYGIGKYLLRHAFEK
DALIPENILMREKAAFSDAVGHSLRDDLQDYAEQHYTDAEAQALYGKYKNPSPFTKESLL
YREIFEKYYPGESQMVIDYWMPNRDWEGCDVNDPSARVLSNYGASGE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatcatgggttacatgggcagccggatgactgccgaagaatttgcggacgca
ctggccgccaccacatccaggggcccggacgccacccggatcaccgatatccccaacggg
tatctcggtttcaaccgactcgctattatggggctgactgcctccggtatgcagccgttt
acacgaaaccggaacgcactggtgtgcaacggtgagatcttcggattccgtcccatcaag
gcacagctggaagccgagggctgccgctttgaaagcgacagcgactgcgaaatcctcctg
ccgatgtatgagaaactgggcaccgacatgttctcccgtctggacggggaatttgccctt
attatatatgatgcagacaaagactccctcatcgcagcccgcgatcccatgggcatcaga
cccctttactactgttatgacagcgatgaaaatattgtgtttgcatctgaaccaaagaat
cttacgaaatatttcgaccgtattatgccgtttccaccagggtattactacgaaaacgga
gagttcatctgttatcgggacatgtcggaatccagtttctattccaaagattctatggac
gaaatcagccgcaacatacacgataagctgatcgccggcgtacgcaagcggatggactcc
gacacaccggtaggctttctgctgagcggaggcctggattcctccctggtctgcggaatt
gcggcccgggacagcagccggccgatccgcacctttgccatcggcatggatacggatgcc
atcgacttgaaatatgcccgggaagtggcggaatatattcacagtgatcacacggaagtc
attatctccgcccaggatgtcatcgatgccctggagccggttatccggattctcggcact
tacgatatcaccaccatccgtgcctccatcggcatgtatctggtgtgtaaatacatccat
gagcacacggatatccgcgtgctgctcaccggcgagatctctgacgaactcttcggctac
aaatataccgatttcgcgccgagtccggaagccttccaggaagaagcccggaaacggatc
cacgaaatccacatgtacgatgtgcttcgggccgaccgctgcatcagcagcaacagcctg
gaagcccgggttcccttcggtgatctggacttcgttgactacgtcatgcatatcgatccg
gagatcaagatgaaccattacggcatcggcaaatatctgctgcgccatgcgtttgaaaaa
gacgccctgatcccggagaatatccttatgcgggaaaaagccgccttttccgacgcggta
ggccattccctgcgggatgacctgcaggactatgcggaacagcactacacagacgccgag
gcccaagccctttacggcaaatacaaaaacccgtcaccctttaccaaagaatccctgctc
taccgggaaatctttgagaaatactatccgggtgaatcccagatggtgatcgactactgg
atgccgaaccgggactgggaaggatgcgatgtcaacgatccttctgcccgtgtactttcc
aactacggcgcttccggcgaatga

DBGET integrated database retrieval system