KEGG   Clostridium sp. SY8519: CXIVA_04160Help
Entry
CXIVA_04160       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CXIVA_04160
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_04160
   00052 Galactose metabolism
    CXIVA_04160
   00500 Starch and sucrose metabolism
    CXIVA_04160
   00520 Amino sugar and nucleotide sugar metabolism
    CXIVA_04160
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CXIVA_04160
   00524 Butirosin and neomycin biosynthesis
    CXIVA_04160
Enzymes [BR:cls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CXIVA_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(442198..443139)
Genome map
AA seq 313 aa AA seqDB search
MKKYAFGVDIGGTTVKIGLFLTEGRMEDSWEIPTRTEDGGRLILGDIAGSIDEKLKEKNI
SKTEIEGIGIDVPGPVLEERIVNKCANLGWGVLDVAEKTAELTGIAKVKVTNDANAATLG
EMWQGGGKNHKDLVMLTLGTGIGGGIVHDGKIISGRFGAAGEIGHMRVNREETLVCGCGK
HGHLEQYASATGIARKAQEMLVQSDRPSMLRNVSYLSAKEVFDCAKKGDELSLEIVEFIG
EELGNACSLIACVFDPEIFVIGGGVSKAGDILIETIQRHYRKYAFHASADAEFALATLGN
DAGMYGAVKMVLD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtatgcgtttggcgtggacatcggcggcacaactgtaaaaatcggcctgttt
ctgaccgagggcagaatggaggacagctgggagattccgacccgtacagaggacggcggg
cggctgatcctgggagatatcgcagggtccattgatgaaaaactgaaagaaaaaaatatt
tcaaagaccgagatcgaaggcatcggcattgatgtgccggggccggtactggaggaacgg
attgtgaacaaatgcgccaatctcggctggggtgttctggatgtggcggaaaagaccgcg
gagctgaccggaatcgccaaagtaaaggtcacgaacgacgcaaatgcggcaaccctgggt
gaaatgtggcagggaggcggaaagaatcacaaagatctggtgatgctgacccttggtacg
ggaatcggcggcggcattgtgcatgacggaaagattatttccggacggttcggagcagcc
ggagagatcgggcatatgcgtgtgaaccgggaggaaacgctggtgtgcggatgcggcaag
cacggccatctggagcagtacgcgtccgccaccggcattgcgcggaaggcccaggagatg
ctggtgcagagcgaccgcccgtccatgctgcggaatgtgtcctatctttccgcgaaagag
gtgtttgactgcgcgaaaaaaggagatgaactgtctctggaaatcgtggaatttatcggt
gaggagctgggaaatgcctgcagtctgattgcctgtgtgttcgatccggagatttttgtc
atcggcggcggtgtttccaaggcaggggatattctgattgaaacgattcagcgccactac
cgcaagtatgccttccacgcttccgcggatgcggaatttgccctggccacactgggcaat
gacgcgggcatgtacggcgcggtgaaaatggtactggattaa

DBGET integrated database retrieval system