KEGG   Clostridium sp. SY8519: CXIVA_05280Help
Entry
CXIVA_05280       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CXIVA_05280
   01230 Biosynthesis of amino acids
    CXIVA_05280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_05280
   00030 Pentose phosphate pathway
    CXIVA_05280
   00051 Fructose and mannose metabolism
    CXIVA_05280
   00052 Galactose metabolism
    CXIVA_05280
  Energy metabolism
   00680 Methane metabolism
    CXIVA_05280
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CXIVA_05280
Enzymes [BR:cls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CXIVA_05280
Protein phosphatases and associated proteins [BR:cls01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CXIVA_05280
Messenger RNA biogenesis [BR:cls03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CXIVA_05280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554260..555234)
Genome map
AA seq 324 aa AA seqDB search
MAKEIKKIGVLTSGGDAPGMNAAIRAVVREAIYQGREVVGVKRGYAGLLDGEIVPMQASS
VSDTIQRGGTILQTARCPEFMTEEGQAKGAQICKENHIDGMVVIGGDGSFRGAQQLAKHG
INTVGIPGTIDLDIGCTDYTIGFDTAINTAMEAIDKIRDTASSHERCSIIEVMGRNAGYI
ALWCGLANGAEQILLPENYDYDEQKLVDDIIARRKFGKTHYIIVNAEGIGHSSSLARRIE
AATGMETRATILGHMQRGGSPTCKDRVYATTMGSIAVDLLCEGKTNRIVGYKDGKFVDFD
IDEALAMTKEIPEYQYNIYKHMAI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaatcaagaaaatcggtgtactgacgagcggcggagacgcgccggggatg
aatgcggccattcgcgcagtagtccgggaagcgatctaccagggcagagaagtggtagga
gtcaagcgcggatatgcaggcctgctggacggtgagatcgtgccgatgcaggcatcttcg
gtgtccgatacgattcagcggggcggaacgattcttcagacagcccgctgcccggaattc
atgaccgaggagggacaggccaaaggcgcgcagatctgcaaggaaaaccacatcgacggc
atggtggtcattggcggagacggttccttccggggtgcgcagcagcttgcgaaacacggc
atcaatacagtaggcatcccgggaaccatcgatctggatatcggatgcacggattatacc
atcggttttgacacagccatcaatacagccatggaagccattgacaaaatcagggatacc
gcctcttcccatgagcgctgcagcatcatagaggttatgggacgcaatgccggctatatc
gctttgtggtgcggcctggccaacggcgcggaacagatcctcctgccggaaaattatgac
tatgatgagcagaagctggtggatgatatcattgcccggagaaaattcggcaaaacccat
tacattattgtaaacgcggagggaatcggccattcctcttcactggccagaagaatcgag
gcagccaccggcatggagaccagggctacgatcctggggcatatgcagcgcggcggttca
ccgacctgcaaagaccgtgtctatgccactaccatggggtccatcgcggtggatctgctg
tgtgaaggaaagaccaaccggatcgtagggtacaaagacggaaaattcgtagactttgac
attgatgaagcactggccatgacaaaggaaattccggaataccagtataatatttacaaa
catatggccatttaa

DBGET integrated database retrieval system