KEGG   Clostridium sp. SY8519: CXIVA_05280Help
Entry
CXIVA_05280       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cls01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cls01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cls00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cls00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cls00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cls00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cls00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554260..555234)
Genome map
AA seq 324 aa AA seqDB search
MAKEIKKIGVLTSGGDAPGMNAAIRAVVREAIYQGREVVGVKRGYAGLLDGEIVPMQASS
VSDTIQRGGTILQTARCPEFMTEEGQAKGAQICKENHIDGMVVIGGDGSFRGAQQLAKHG
INTVGIPGTIDLDIGCTDYTIGFDTAINTAMEAIDKIRDTASSHERCSIIEVMGRNAGYI
ALWCGLANGAEQILLPENYDYDEQKLVDDIIARRKFGKTHYIIVNAEGIGHSSSLARRIE
AATGMETRATILGHMQRGGSPTCKDRVYATTMGSIAVDLLCEGKTNRIVGYKDGKFVDFD
IDEALAMTKEIPEYQYNIYKHMAI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaatcaagaaaatcggtgtactgacgagcggcggagacgcgccggggatg
aatgcggccattcgcgcagtagtccgggaagcgatctaccagggcagagaagtggtagga
gtcaagcgcggatatgcaggcctgctggacggtgagatcgtgccgatgcaggcatcttcg
gtgtccgatacgattcagcggggcggaacgattcttcagacagcccgctgcccggaattc
atgaccgaggagggacaggccaaaggcgcgcagatctgcaaggaaaaccacatcgacggc
atggtggtcattggcggagacggttccttccggggtgcgcagcagcttgcgaaacacggc
atcaatacagtaggcatcccgggaaccatcgatctggatatcggatgcacggattatacc
atcggttttgacacagccatcaatacagccatggaagccattgacaaaatcagggatacc
gcctcttcccatgagcgctgcagcatcatagaggttatgggacgcaatgccggctatatc
gctttgtggtgcggcctggccaacggcgcggaacagatcctcctgccggaaaattatgac
tatgatgagcagaagctggtggatgatatcattgcccggagaaaattcggcaaaacccat
tacattattgtaaacgcggagggaatcggccattcctcttcactggccagaagaatcgag
gcagccaccggcatggagaccagggctacgatcctggggcatatgcagcgcggcggttca
ccgacctgcaaagaccgtgtctatgccactaccatggggtccatcgcggtggatctgctg
tgtgaaggaaagaccaaccggatcgtagggtacaaagacggaaaattcgtagactttgac
attgatgaagcactggccatgacaaaggaaattccggaataccagtataatatttacaaa
catatggccatttaa

DBGET integrated database retrieval system