KEGG   Clostridium sp. SY8519: CXIVA_05500Help
Entry
CXIVA_05500       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00010  Glycolysis / Gluconeogenesis
cls00030  Pentose phosphate pathway
cls00051  Fructose and mannose metabolism
cls00680  Methane metabolism
cls01100  Metabolic pathways
cls01110  Biosynthesis of secondary metabolites
cls01120  Microbial metabolism in diverse environments
cls01130  Biosynthesis of antibiotics
cls01200  Carbon metabolism
Module
cls_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_05500
   00030 Pentose phosphate pathway
    CXIVA_05500
   00051 Fructose and mannose metabolism
    CXIVA_05500
  Energy metabolism
   00680 Methane metabolism
    CXIVA_05500
Enzymes [BR:cls01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CXIVA_05500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: BAK46517
UniProt: F7V8Q7
Position
complement(583345..585309)
Genome map
AA seq 654 aa AA seqDB search
MNKHELKYLKVLSNQYPSISSAATEIINLKAILSLPKGTEHFISDLHGEYEQFIHIMNNG
SGAVRRKIEDEFGVSLSVVEKRQLSMLIYYPELKIRQIEKQITDKEELEDWYRVTILRLC
RVCRQAASKYTRSKVRKAMPKDFAYIMDELMNGRTDIADQEAYYQQIVNSVIETRRADEM
IIDFCKLIRRFVIDHLHVLGDIFDRGQYPHLIMDELMKHHSLDIQWGNHDIIWMGAAAGS
EACMCNMLRISAKYGNLSILEDNYGINLLPLAQLALKVYANDPCKAFHLTVDDEDYDQTN
RSLDEKMHKAIAIIQFKVEGQLIRKHPEFHMDDRLLMEKIDLKKGTVLCYGVEYPLTDTN
FPTMDPKDPYKLSPEEEEVVRRLRASFEGSVRLQEHIRFLYKKGSLYKVYNGNLLFHGCV
PLKEDGTFNEVEIYGKKYKGKALYDILDFYARRGYFSTDPEEKKRGQDILWFIWKNKESP
VFGKDKMTTFERYFIADKRTHEEPKNPYYHLYEKKEVVNRILHEFGLTSEDSHIINGHMP
VKAKKGESPAKCGGKVLVIDGGFSKAYQKTTGLAGYTLTYNSYGLILTAHQPFLSLEDTV
LKEQDVESEIILKQGVIQRKRVGDTDTGKVLQENIEELEQLLQAYRSGEILEKE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaacatgaactgaaatatctgaaagtactgtccaaccagtacccgagtatttcc
tctgcggccactgagatcatcaatctgaaagcaatcctgagccttccgaaggggacggag
cattttatttccgatctgcacggggagtacgagcagtttatccacattatgaataacggt
tccggcgcagtccgccgcaagatcgaggacgaatttggggtgtccctgtctgtggtggag
aagcgtcagctctctatgctgatctactatccggaactgaagatccggcagattgagaag
cagattacagacaaagaggaactggaagactggtaccgggtgacgattttaagactctgc
agagtctgcagacaggccgccagcaagtacaccagatccaaagtgcgtaaggccatgccc
aaggattttgcctatatcatggacgagctgatgaacggcagaaccgatattgcggaccag
gaggcgtactatcagcagattgtgaattctgtcatcgagacccggcgggccgatgaaatg
atcatagatttctgcaagctgatccgccggtttgtcattgaccatctgcatgttttaggg
gatatctttgaccgtggccagtatccccacctgattatggacgaactgatgaagcaccac
tccctggatattcagtggggcaatcatgacatcatctggatgggggcagcggccggcagc
gaggcctgcatgtgcaacatgctgcggatctctgccaaatacggcaatctgtccatcctg
gaggacaattacggcatcaaccttctgccgctggcccagctggcgctgaaggtttacgcc
aatgatccctgcaaggccttccatctgaccgtggatgatgaagactatgatcagacgaac
cggagcctggatgaaaagatgcacaaagccatcgccatcattcagtttaaagtggaagga
cagctgatccgcaagcatccggagttccatatggatgaccgcctgctcatggaaaaaatt
gatttaaagaaaggcactgttctgtgctatggcgtggagtatccgctgacagatacgaat
ttccctacgatggatcccaaggatccctacaagctttccccggaagaggaagaagtggtc
cggcggctgcgggcaagttttgaaggcagtgtgcggctgcaggagcacatccggttcctt
tacaaaaagggaagtctgtataaagtatataatggaaatcttctgtttcacgggtgtgtg
ccgctgaaggaagacggaaccttcaatgaggtggagatctacggcaaaaaatacaagggc
aaggcactgtatgacatccttgatttttatgcgcgccggggatatttttccacagatccg
gaagaaaagaaacggggacaggatattctctggtttatctggaaaaacaaggaatcgccg
gtgtttggcaaagataagatgaccacgtttgaacgctatttcatcgcggacaaacgaacc
cacgaagagccgaagaatccatactatcatctgtatgagaagaaagaagtggtgaaccgg
atcctacacgaattcgggctgacttccgaagattcccatattatcaacggccatatgccg
gtgaaggcaaagaagggagagtctcccgccaaatgcggcggcaaggtgcttgtcatagac
ggcggtttttccaaggcatatcagaagaccaccggactggcaggttataccctgacgtac
aattcctacggactgatccttacggcccaccagcccttcctgtcactggaggacacggtg
ttaaaggaacaggatgtggaatccgagattatcctgaaacagggcgtcatccagcgcaag
cgggtcggagatacggataccggcaaggtattacaggaaaatatcgaagaactggagcag
cttctgcaggcataccgcagcggcgaaatcctggaaaaagaataa

DBGET integrated database retrieval system