KEGG   Clostridium sp. SY8519: CXIVA_07350Help
Entry
CXIVA_07350       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cls00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790119..791621
Genome map
AA seq 500 aa AA seqDB search
MADYIMALDAGTTSSRCILFDRSGRECGMAQQEFNQIFPQPGWVEHDPNEIWQTQLSVAR
KAMNQMHITFRDIAAIGIANQRETVILWDRRTGQPVCNAIVWQCRRTADDVERIKTEHPE
YPQIFRDKTGLILDPYFSGTKIRWILDHVDGALEKAQRGDLCFGTVDSWLIYKLTKGRVH
VTDYSNASRTLLFNIHTLSWDEELCNILEIPASILPEVKPSSCIYGETDPEFFGGPIPIA
GAAGDQQAALFGQNCLRPGEAKNTYGTGCFTLMNIGNIPLLSASGLLTTIAWGLNNEITY
ALEGSVYVAGAAIQWLRDEMDLIDSSSDSEYFATRVPDTNGCYVVPAFTGLGAPYWDPYA
RGVITGLTRGVSKCHLIRATLESIAFQSYDVLHTMEADAGIRLRTLKVDGGASRNNFLMQ
FQADIANTEIQRPRCVETTALGAACLAGLAVSHWSCTEEITDNWTLDRAFLPQMSSDRRR
RELAGWKKAVSASRGWAREY
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcagactatattatggcgcttgatgccggcactaccagcagccgctgtattctcttc
gaccgctccggccgggagtgcggtatggcacagcaggaattcaaccagatttttccccag
cccggctgggtcgagcacgacccgaatgaaatctggcagacccagctgtcggttgcccgg
aaagccatgaatcaaatgcacatcacattccgggatattgccgccatcggcattgccaac
cagcgggaaacggtcatcctgtgggatcggcgcaccggccagcctgtctgcaacgcaatc
gtctggcagtgccgccgcacggctgatgatgtggaacgaatcaaaacagaacatccggaa
tacccgcagatcttccgggataaaaccggactgattctggatccttatttttccggcacc
aaaatccgctggatcctggatcatgtcgacggagccctggaaaaagcgcagcgcggagac
ctctgtttcggcaccgtagacagctggctgatctacaagctcaccaaaggccgggtgcat
gtgactgattattccaatgcttcccgcacacttctttttaatattcacaccctgtcctgg
gatgaagaactctgtaatattctggaaatccccgcttcgatcctgccggaggtcaaaccc
tccagctgtatatacggagaaacggacccggaattcttcggcggaccgatccccattgcc
ggcgctgccggtgaccagcaggccgccctgttcggccagaactgcctgcgccccggagag
gcaaaaaacacctacggcaccggatgctttactctgatgaacattggaaacattccgctg
ctctccgccagcggtctgctgactaccattgcctggggactgaacaatgaaatcacctac
gccctggaaggctcggtctatgtggccggagccgccatccagtggctgcgggacgaaatg
gatctcatcgattcctcttccgactccgaatactttgccacccgtgttccggacaccaac
ggctgttatgtggtccccgcatttaccggcctgggcgcgccttactgggatccttacgcc
cgcggcgtcatcaccgggctcacccgcggcgtcagcaaatgccatctgatccgcgccacc
ctggaatccattgcgtttcaaagctatgacgtgctccataccatggaggctgacgccggc
attcggctccgcaccctgaaagtggacggcggcgcttccaggaacaacttcctgatgcag
tttcaggcagacatcgcgaataccgaaatccagcgccccagatgtgtggaaactaccgcg
ctgggagctgcctgtctggccggtcttgctgtttcacactggtcctgtacggaagaaatc
accgacaactggaccctggaccgggctttcctgccgcagatgtcttccgaccggcgccgc
cgggagctggcaggctggaaaaaagctgtatccgcctcccgggggtgggcaagggaatac
tga

DBGET integrated database retrieval system