KEGG   Clostridium sp. SY8519: CXIVA_07350Help
Entry
CXIVA_07350       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CXIVA_07350
Enzymes [BR:cls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CXIVA_07350
Exosome [BR:cls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CXIVA_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790119..791621
Genome map
AA seq 500 aa AA seqDB search
MADYIMALDAGTTSSRCILFDRSGRECGMAQQEFNQIFPQPGWVEHDPNEIWQTQLSVAR
KAMNQMHITFRDIAAIGIANQRETVILWDRRTGQPVCNAIVWQCRRTADDVERIKTEHPE
YPQIFRDKTGLILDPYFSGTKIRWILDHVDGALEKAQRGDLCFGTVDSWLIYKLTKGRVH
VTDYSNASRTLLFNIHTLSWDEELCNILEIPASILPEVKPSSCIYGETDPEFFGGPIPIA
GAAGDQQAALFGQNCLRPGEAKNTYGTGCFTLMNIGNIPLLSASGLLTTIAWGLNNEITY
ALEGSVYVAGAAIQWLRDEMDLIDSSSDSEYFATRVPDTNGCYVVPAFTGLGAPYWDPYA
RGVITGLTRGVSKCHLIRATLESIAFQSYDVLHTMEADAGIRLRTLKVDGGASRNNFLMQ
FQADIANTEIQRPRCVETTALGAACLAGLAVSHWSCTEEITDNWTLDRAFLPQMSSDRRR
RELAGWKKAVSASRGWAREY
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcagactatattatggcgcttgatgccggcactaccagcagccgctgtattctcttc
gaccgctccggccgggagtgcggtatggcacagcaggaattcaaccagatttttccccag
cccggctgggtcgagcacgacccgaatgaaatctggcagacccagctgtcggttgcccgg
aaagccatgaatcaaatgcacatcacattccgggatattgccgccatcggcattgccaac
cagcgggaaacggtcatcctgtgggatcggcgcaccggccagcctgtctgcaacgcaatc
gtctggcagtgccgccgcacggctgatgatgtggaacgaatcaaaacagaacatccggaa
tacccgcagatcttccgggataaaaccggactgattctggatccttatttttccggcacc
aaaatccgctggatcctggatcatgtcgacggagccctggaaaaagcgcagcgcggagac
ctctgtttcggcaccgtagacagctggctgatctacaagctcaccaaaggccgggtgcat
gtgactgattattccaatgcttcccgcacacttctttttaatattcacaccctgtcctgg
gatgaagaactctgtaatattctggaaatccccgcttcgatcctgccggaggtcaaaccc
tccagctgtatatacggagaaacggacccggaattcttcggcggaccgatccccattgcc
ggcgctgccggtgaccagcaggccgccctgttcggccagaactgcctgcgccccggagag
gcaaaaaacacctacggcaccggatgctttactctgatgaacattggaaacattccgctg
ctctccgccagcggtctgctgactaccattgcctggggactgaacaatgaaatcacctac
gccctggaaggctcggtctatgtggccggagccgccatccagtggctgcgggacgaaatg
gatctcatcgattcctcttccgactccgaatactttgccacccgtgttccggacaccaac
ggctgttatgtggtccccgcatttaccggcctgggcgcgccttactgggatccttacgcc
cgcggcgtcatcaccgggctcacccgcggcgtcagcaaatgccatctgatccgcgccacc
ctggaatccattgcgtttcaaagctatgacgtgctccataccatggaggctgacgccggc
attcggctccgcaccctgaaagtggacggcggcgcttccaggaacaacttcctgatgcag
tttcaggcagacatcgcgaataccgaaatccagcgccccagatgtgtggaaactaccgcg
ctgggagctgcctgtctggccggtcttgctgtttcacactggtcctgtacggaagaaatc
accgacaactggaccctggaccgggctttcctgccgcagatgtcttccgaccggcgccgc
cgggagctggcaggctggaaaaaagctgtatccgcctcccgggggtgggcaagggaatac
tga

DBGET integrated database retrieval system