KEGG   Clostridium sp. SY8519: CXIVA_08480Help
Entry
CXIVA_08480       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cls  Clostridium sp. SY8519
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CXIVA_08480
Enzymes [BR:cls01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CXIVA_08480
Exosome [BR:cls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CXIVA_08480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(904368..906266)
Genome map
AA seq 632 aa AA seqDB search
MSNITEYDMYLFGCGTHYEIYRKLGAHPHREKGKTGVVFDVWAPHAREVYLIGEFNGWDE
TADPMRRLEPAGIYELFSDKARPGQMYKYLIVTQDGRKLYKADPYANYAELRPGTASRIA
DISKFTWTDEKWMTRRDDKEHAAVYEEPLAIYEVHPGSWKRHPGTEEDGFYSYRELAQEL
TAYVKDMGYTHVELMGISEYPFDGSWGYQVTGYYAPTSRYGTPEDFAWMVNYFHKHGIGV
ILDWVPAHFPKDAHGLADFDGQALYEYADPRKGEHPDWGTKIFDYSRTEVQNFLIGSALL
WVEQYHVDGLRVDAVASMLYLDYGKEPGQWVPNRYGENKNLEAIEFFRHLNTLITGRNHG
VMMIAEESTAWPQVTGSAEDGGLNFTYKWNMGWMHDFLDYMQLDPYFRKDNHHKMTFAMS
YNTSEKYILVLSHDEVVHLKKSMLSKMPGSEQDKFRNLMVGYAFMMGHPGKKLLFMGQDF
GQLREWSETRELDWYLLEETPHRQLHDFYRSLLHIYRRYPSMYTMDHDWEGFEWINADDG
YRSIYSFVRHGKTGRNSLLFVCNFTPVAYPDYRVGVPKKKRYELILNSDDAAYGGSGEKR
QKTYTAQASECDGREYSFAYPLPAYGVAVFKF
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcacagaatatgacatgtatctgtttggatgcggcacccactatgaaata
taccggaagcttggcgcccatccgcacagagagaaaggaaaaacaggcgttgttttcgat
gtgtgggcgcctcatgccagagaagtctatctgatcggagagtttaacggatgggatgaa
acggcggatcccatgcgtcgtctggaaccggcggggatctatgagctgttcagcgacaaa
gcccgtccgggacagatgtataagtatttaatcgtgacacaggacggccgcaaactgtac
aaggccgatccttacgcgaactatgcggaactgcggccgggcactgcctcacggatcgcg
gatatcagcaaattcacctggaccgatgaaaaatggatgaccaggcgggatgacaaggaa
catgcggcagtctatgaagagccgctggcgatctacgaagtgcatcccggatcctggaaa
cgccatcccggcacggaagaggatggattttactcctaccgggaactggcgcaggagctg
accgcgtatgtcaaagacatgggatatacccatgtggagcttatggggatttccgagtat
ccgtttgacggttcctgggggtatcaggtcaccggctactacgcgccgacgtcccgatac
ggcacaccggaggactttgcctggatggtaaattatttccataagcacggaatcggtgtc
attctggactgggtaccggcacattttccgaaggacgcccacggcctggcggattttgac
ggacaggcactgtatgaatacgcggatccgcgaaaaggggagcatccggactggggtaca
aaaatcttcgactattcccgtacagaggttcagaattttctgatcggcagcgcgctgctg
tgggtggaacaatatcacgtagacggcctgcgtgtggacgcggtggcctccatgctgtat
ctggattacggaaaagagcccggtcagtgggtgccgaaccgttacggcgagaacaaaaac
ctggaagccatcgaatttttccgacatttaaatacgctgattaccggccggaaccacggg
gtcatgatgattgcggaggaatccaccgcatggccgcaggtgacgggcagcgcggaagac
ggcggactgaattttacctacaaatggaacatgggatggatgcacgacttcctggactat
atgcagctggatccgtatttccggaaggataaccaccataaaatgacctttgccatgagc
tacaataccagtgaaaaatatatcctggtgctttcccatgacgaggtggtgcatttaaag
aaatccatgctgagcaagatgcccggttccgagcaggacaagttccgcaacctgatggtg
ggctatgcgtttatgatgggacatccgggcaagaagcttctgtttatgggacaggatttc
ggacagctgcgggaatggagcgaaaccagggaactggactggtatctgctggaggaaaca
ccccatcggcagctccacgacttttacagaagcctgctccacatttaccgccggtatccg
tcgatgtatacgatggaccatgactgggaaggctttgagtggatcaacgcggacgacggc
taccgcagcatctacagctttgtccgccatggaaagaccggccggaacagcctgcttttt
gtatgcaactttacaccggtggcttatccggattaccgggtgggcgtaccgaaaaagaaa
cgctatgagctgattttaaacagtgatgacgcggcctacggcggcagcggggaaaaacgg
cagaaaacctataccgcccaggcttccgaatgtgatggcagagagtattcgtttgcctat
ccgcttccggcttacggcgtggcagttttcaaattctaa

DBGET integrated database retrieval system