KEGG   Clostridium sp. SY8519: CXIVA_09250Help
Entry
CXIVA_09250       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K06187  
recombination protein RecR
Organism
cls  Clostridium sp. SY8519
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cls00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CXIVA_09250
DNA repair and recombination proteins [BR:cls03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CXIVA_09250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995628..996224)
Genome map
AA seq 198 aa AA seqDB search
MDYYSKQISRLIEELSGLPGIGSKSAQRLAFHILNMPKDRVEVLADTIRSARENIRYCKT
CFTLTDAEECPICSNPKRDHSTIMVVENTRDLAAYEKTGQYEGVYHVLHGAISPMLGIGP
EDIRLKELMQRLAGDVKEVIIATNSSLEGETTAMYISKLIKPTGIRVSRIASGVPVGGDL
EYIDEVTLLRALDGRVEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattattacagcaaacagatcagccggctgatcgaggaactgtccggcctgcccggg
atcggcagcaaatcggcccagcgtctggcatttcatattctgaatatgcccaaagaccgc
gtggaagtgctggcggatacgattcgcagcgccagggaaaacatcagatactgcaaaacc
tgcttcactctgacagatgcggaagagtgtccgatctgcagtaacccgaagcgggatcat
tccacaatcatggtagttgaaaacaccagggacctggcagcctatgagaaaacaggccag
tatgaaggcgtctaccatgtgctccacggagcgatttcgcccatgctgggaatcggtccg
gaagacatccgcctaaaggagctgatgcagcgtctggccggcgatgtgaaggaagtgatc
atcgcgacgaattccagcctggaaggggaaaccacagccatgtacatcagcaaactgatc
aaacccacggggatccgcgtgtcaagaatagccagcggagtaccggtagggggagatctg
gagtatattgacgaggtgacgctgctgcgggcattagatggaagagtggagctgtaa

DBGET integrated database retrieval system