KEGG   Clostridium sp. SY8519: CXIVA_09480Help
Entry
CXIVA_09480       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cls  Clostridium sp. SY8519
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cls00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021050..1021871
Genome map
AA seq 273 aa AA seqDB search
MQIGRHAFDTEHHTYIMGILNVTPDSFSDGGRWNTLDHALEHTESMIQEGADLIDIGGES
TRPGYTKISDEEEIHRVVPVIQAIRKRFDIPISVDTYKSKVAEAALEAGADLINDIWGLK
YDPRMASVIAASGAACCLMHNRKNGQYSSFASDLKQDLLESVRLAETAGISRDKIILDPG
IGFAKDYEQNLETMRILPELCRLPYPMLLGTSRKSMIGNCLHLPTEERLEGTLATTVLAV
QAGCGFVRVHDIQANQRAIQMTEAILKRGVQKK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcggcagacatgcgtttgatacggaacaccatacatatattatggggattctc
aatgtgacaccggattccttttctgacggcggcaggtggaatactttggatcatgcgctg
gaacatacggaatccatgattcaggaaggagcagatctgatcgatatcggcggagaatcc
accagaccgggatatacaaagatcagtgacgaagaggaaatccaccgcgtggtaccggtg
attcaggccatacggaagcgttttgacattccgatttccgtggatacttacaaatcaaag
gttgcggaagctgccctggaagcaggggccgacctgatcaatgatatctggggactgaaa
tatgatccgcgtatggcgtcggtaattgctgcctccggcgcggcctgctgtctgatgcac
aatcggaaaaacgggcagtattcatcgtttgcttccgatctgaagcaggatctgttggaa
agtgtccggctggcagaaacagccggtatttccagagataaaattattctggatccgggg
attggatttgcgaaagattatgaacagaacctggagaccatgcgcattctgccggaactg
tgccggctgccctatccgatgctgcttggaacttcaagaaaatccatgatcggcaactgc
cttcatctgccaacagaagagcgcctggaaggcacgctggcgactacggtgcttgctgtg
caggcaggatgcggatttgtgcgtgtgcatgatattcaggcaaatcagagagccatccag
atgacagaagcaattttaaagcgcggggtacagaagaaataa

DBGET integrated database retrieval system