KEGG   Clostridium sp. SY8519: CXIVA_11720Help
Entry
CXIVA_11720       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00520  Amino sugar and nucleotide sugar metabolism
cls00550  Peptidoglycan biosynthesis
cls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CXIVA_11720
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CXIVA_11720
Enzymes [BR:cls01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CXIVA_11720
Peptidoglycan biosynthesis and degradation proteins [BR:cls01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   CXIVA_11720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Rep_fac-A_3
Motif
Other DBs
NCBI-ProteinID: BAK47138
UniProt: F7V309
Position
1262103..1263395
Genome map
AA seq 430 aa AA seqDB search
MDQYVIKGGNPLRGEVEIGGAKNAALAILAAAVMADETVTIENIPNVRDINVMLEAIAGI
GAHVDRVDVHTVRINGSYISNVNVDDEAIKRIRASYYLLGALLGKYKEARVALPGGCAIG
SRPIDLHLKGFRALGCQVDIQQGQVVARADSLTGTHIYLDKVSVGATINIMMAASMAEGK
TIIENAAKEPHVVDVANFLNCMGASIRGAGTDVIRISGVEKFHSTEYACISDQIEAGTFM
MAAAATGGDVTVRNVIPKHLEATSAKLIEVGCRIEEFDDAVRVTAPETLHHTQVTTLAYP
GFPTDMQPQMGVVLALSEGTSTITESIFENRFKYVDELVCMGARIKVEGNIAIINGVEGF
TGARVSAPDLRAGAALVIAGLAAEGITTVDDIYYIERGYETFDAKLRSLGGQIEKVSSEK
EIQKFKLKIS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtacgtaatcaaaggcgggaatcccctgagaggcgaggttgagatcggcgga
gcgaagaatgcggctctggcgattcttgctgcggctgtcatggcggacgagaccgtaaca
atagagaatataccgaatgtgcgggacattaacgtgatgctggaggcaattgcgggaatc
ggtgcccatgtggaccgggtggatgtgcataccgtccgcatcaacgggagctatatcagc
aatgtgaacgtagatgacgaggcaatcaagcgtatccgtgcctcctattatctgctgggc
gcgctgctgggcaaatataaggaagcccgtgtggcgctgccgggcggatgcgccatcgga
agcaggcccattgacctgcatctgaaggggttccgtgccctggggtgtcaggtggacatc
cagcaggggcaggtggtggcccgggcagacagcctgaccgggacccatatctacctggat
aaggtgtctgtaggcgccacgattaatattatgatggcggcctccatggcagaaggcaag
acaattatcgaaaatgccgccaaagagccccatgtggtggacgtggccaatttcctcaac
tgtatgggtgccagcatccgcggcgccggcacggatgtgatccgtatttccggtgtggag
aagttccacagcaccgaatacgcgtgcatttcggatcagattgaagcgggcacattcatg
atggcagcggccgccaccggcggagacgttaccgtacgcaacgtcattcccaagcatctg
gaagccacttccgccaaactgatcgaagtgggctgccgcatcgaggagtttgacgacgct
gtccgggttaccgcgccggagaccctgcatcatacccaggtgacgacactggcatatccg
ggattccccacagatatgcagccgcagatgggcgtggtccttgcgctgtcggaaggcacc
agcacgattacggagagtattttcgagaatcgctttaaatatgtggacgaactggtctgt
atgggagccaggattaaagtagagggcaacatcgccattatcaacggcgtggagggcttt
accggcgcccgggtcagcgcgccggatcttcgggccggagcggctttggtcatcgccggc
ctggcagcggaaggcattaccaccgtagatgatatctactatattgaacgggggtacgaa
acctttgacgcgaagctccgttccctgggcggacagatcgagaaggtcagctcagaaaaa
gaaatccagaaattcaaattaaagatctcatga

DBGET integrated database retrieval system