KEGG   Clostridium sp. SY8519: CXIVA_11720Help
Entry
CXIVA_11720       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cls  Clostridium sp. SY8519
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cls00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cls00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262103..1263395
Genome map
AA seq 430 aa AA seqDB search
MDQYVIKGGNPLRGEVEIGGAKNAALAILAAAVMADETVTIENIPNVRDINVMLEAIAGI
GAHVDRVDVHTVRINGSYISNVNVDDEAIKRIRASYYLLGALLGKYKEARVALPGGCAIG
SRPIDLHLKGFRALGCQVDIQQGQVVARADSLTGTHIYLDKVSVGATINIMMAASMAEGK
TIIENAAKEPHVVDVANFLNCMGASIRGAGTDVIRISGVEKFHSTEYACISDQIEAGTFM
MAAAATGGDVTVRNVIPKHLEATSAKLIEVGCRIEEFDDAVRVTAPETLHHTQVTTLAYP
GFPTDMQPQMGVVLALSEGTSTITESIFENRFKYVDELVCMGARIKVEGNIAIINGVEGF
TGARVSAPDLRAGAALVIAGLAAEGITTVDDIYYIERGYETFDAKLRSLGGQIEKVSSEK
EIQKFKLKIS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtacgtaatcaaaggcgggaatcccctgagaggcgaggttgagatcggcgga
gcgaagaatgcggctctggcgattcttgctgcggctgtcatggcggacgagaccgtaaca
atagagaatataccgaatgtgcgggacattaacgtgatgctggaggcaattgcgggaatc
ggtgcccatgtggaccgggtggatgtgcataccgtccgcatcaacgggagctatatcagc
aatgtgaacgtagatgacgaggcaatcaagcgtatccgtgcctcctattatctgctgggc
gcgctgctgggcaaatataaggaagcccgtgtggcgctgccgggcggatgcgccatcgga
agcaggcccattgacctgcatctgaaggggttccgtgccctggggtgtcaggtggacatc
cagcaggggcaggtggtggcccgggcagacagcctgaccgggacccatatctacctggat
aaggtgtctgtaggcgccacgattaatattatgatggcggcctccatggcagaaggcaag
acaattatcgaaaatgccgccaaagagccccatgtggtggacgtggccaatttcctcaac
tgtatgggtgccagcatccgcggcgccggcacggatgtgatccgtatttccggtgtggag
aagttccacagcaccgaatacgcgtgcatttcggatcagattgaagcgggcacattcatg
atggcagcggccgccaccggcggagacgttaccgtacgcaacgtcattcccaagcatctg
gaagccacttccgccaaactgatcgaagtgggctgccgcatcgaggagtttgacgacgct
gtccgggttaccgcgccggagaccctgcatcatacccaggtgacgacactggcatatccg
ggattccccacagatatgcagccgcagatgggcgtggtccttgcgctgtcggaaggcacc
agcacgattacggagagtattttcgagaatcgctttaaatatgtggacgaactggtctgt
atgggagccaggattaaagtagagggcaacatcgccattatcaacggcgtggagggcttt
accggcgcccgggtcagcgcgccggatcttcgggccggagcggctttggtcatcgccggc
ctggcagcggaaggcattaccaccgtagatgatatctactatattgaacgggggtacgaa
acctttgacgcgaagctccgttccctgggcggacagatcgagaaggtcagctcagaaaaa
gaaatccagaaattcaaattaaagatctcatga

DBGET integrated database retrieval system