KEGG   Clostridium sp. SY8519: CXIVA_15070Help
Entry
CXIVA_15070       CDS       T01565                                 

Gene name
HemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cls  Clostridium sp. SY8519
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CXIVA_15070 (HemB)
Enzymes [BR:cls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CXIVA_15070 (HemB)
Exosome [BR:cls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CXIVA_15070 (HemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1631898..1632866
Genome map
AA seq 322 aa AA seqDB search
MRRFRRLRQSEKMREFVRENRVTAQDLIYPLFIEEGENIKNPVPSMPQVYQYSLDRVHEI
LDELTELKIPAVLLFGIPAHKDPEGSSAYDPHGVVQEAIRYIRKNYPQLLIIADICLCEY
TSHGHCGLVQGETILNDATLPLLARMAVTAAQAGADIVAPSDMMDGRVAAIREALDAADL
SQVPILSYSAKYASGYYGPFRDAAGSAPHFGDRKSYQMDPANGREAMREIQDDLEEGADM
IIVKPALAYLDILREAREQVSVPIVTYNVSGEYAMVKAAAQNGWIDERRIVLENMTAMKR
AGADRIITYHALDVARWLQEEN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagacgttttcgcagactgagacagtcagaaaaaatgagagagtttgtccgggaaaac
cgggtaacagcgcaggatttgatctatccgctgtttattgaagagggagaaaatatcaaa
aacccggttccttccatgccgcaggtgtatcagtattcgctggaccgggtgcatgagatt
ctggatgagctgaccgaattaaaaattcctgcagtgctgctgtttggcattccggcgcat
aaagacccggaaggaagcagcgcttacgatccccatggggtggttcaggaagcgatccgc
tatatccggaaaaattatccgcagctgctgattatcgcggatatctgcctgtgtgaatat
acgtcccacggacactgcggtctggtgcagggagaaaccattttaaatgacgcgaccctg
cccctgctggcccgtatggctgtgactgccgcacaggccggcgcggatatcgtggcgcct
tcggatatgatggacggccgcgtggcggcgattcgcgaagcgttagacgcggcggatctg
tcgcaggtaccgatcttaagctacagcgcgaaatatgcctccggctattacggcccgttc
cgtgacgcggcgggatccgccccccatttcggcgaccggaaatcctatcagatggatccg
gccaacggaagggaagccatgcgggagattcaggatgacctggaagaaggggcggatatg
attatcgtaaagccggcgctggcatacctggacattctgagagaagccagagagcaggtt
tctgtaccaattgtaacttataatgtctccggcgaatatgccatggtcaaggcagcggcc
caaaacggctggatcgatgaacggcggattgtgctggagaatatgacagccatgaaacgg
gccggcgccgaccggattatcacctatcacgcgctggatgtagcccgctggctgcaggaa
gaaaactaa

DBGET integrated database retrieval system