KEGG   Clostridium sp. SY8519: CXIVA_15350Help
Entry
CXIVA_15350       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cls  Clostridium sp. SY8519
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CXIVA_15350
Enzymes [BR:cls01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CXIVA_15350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1657991..1659472
Genome map
AA seq 493 aa AA seqDB search
MRASGILLPVSSLPSPYGIGCFSREALEWIDFLKKSGQKYWQILPLGPVSYGDSPYQSFS
TFAGNPLYISLEGLVVEGLLSREECEAAELDDGSGYVDYGCQFRRRYQLLYQAYVRSGCQ
QEERYQAFCRDSRSWLEDYALFMALKEENGWKAFTEWSEDLRLRRPEALRKARARLEDRV
EFYCYLQYLFDQQWSQVRRYANENGIRVIGDIPIYVSMDSADVWTRPELFQLDENRRPKA
VAGCPPDAFSADGQLWGNPLYDWEAHRKESYRWWLDRIRHCAKLYDVVRIDHFRGFDSYY
SIPYGDETARNGSWEPGPGMELFHFVKKEIPELAIIAEDLGFMTDSVRQLVRDSGYPNMK
VLQFAFGSDARNEYLPFWYERNCVVYTGTHDNETLLQHIEAAGEQEKNRIREYTGLADGD
DSALCEGVIRMAFASVADTCIIPMQDYLQIGAEGRMNYPSTLGGNNWKWRMKKEDLTEER
SARIRHLTELYAR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcaagcggcatattgcttccggtcagcagccttccgtccccgtacggcatcggc
tgtttttccagagaagcgctggagtggatagattttctgaaaaaaagcggacagaagtac
tggcagattcttccgcttggcccggtcagttacggggattccccgtatcagtcattttca
acctttgcgggaaacccgctgtatatttccctggaggggctggtggtagaagggctgctg
agcagggaagagtgtgaggcggcagaactggatgacggcagtggatatgtggattacggc
tgtcagttccgccgcaggtatcagctgctgtatcaggcgtatgtacgcagcggatgccag
caggaggaacggtaccaggccttctgccgggacagcagaagctggctggaagactacgcg
ctgtttatggccctgaaagaggagaatggctggaaggcctttacggagtggagcgaagat
ctgcgtctgcggcgtccggaagcgctgcggaaagcgcgggcgcgtctggaagaccgggtg
gagttttactgttatctccagtacctgtttgatcagcagtggagccaggtgcgccgctat
gccaatgaaaacgggatccgcgttatcggggacatcccgatctatgtttccatggacagt
gcggatgtctggaccaggccggagctgtttcagctggatgaaaaccggcgtccgaaggct
gtggcagggtgtccgccggatgctttttcagcggacggacagctgtggggcaatccgctg
tatgactgggaggcccacaggaaggaatcctaccggtggtggctggatcggatccgccac
tgcgcgaaactgtacgatgtggtaagaattgatcacttccggggatttgattcctattat
tccattccatacggggatgagactgccagaaacggcagctgggagccgggaccgggcatg
gagctgttccattttgtgaaaaaagagattccggagctggcaattatcgcggaggatctg
ggatttatgacggattcggtccgtcagctggtccgggacagcggctatccgaatatgaaa
gtcctgcagtttgccttcggatccgacgcgcggaatgaatatctgcccttctggtatgaa
cggaactgtgtggtatacaccggcacccatgacaacgaaaccctgctgcagcacatcgaa
gccgcgggcgaacaggaaaaaaacagaatccgggaatataccggtcttgcggacggggac
gacagcgcgctgtgtgaaggcgtgatacgcatggcatttgcttccgtggcggatacctgc
atcattcccatgcaggattatctgcagatcggcgcggaagggcgcatgaattatccgtcc
accctaggcggaaacaactggaaatggcggatgaagaaagaagatctgacggaggaaaga
agcgcccggatccgtcacctgacagaattgtatgcccgttag

DBGET integrated database retrieval system