KEGG   Clostridium sp. SY8519: CXIVA_16490Help
Entry
CXIVA_16490       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cls  Clostridium sp. SY8519
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CXIVA_16490
   00670 One carbon pool by folate
    CXIVA_16490
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CXIVA_16490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1784885..1785397
Genome map
AA seq 170 aa AA seqDB search
MKLIAAADKNWGIGKNNQLLVSIPEDMKFFRSTTMNGVVVMGRRTLDSFPGGRPLPRRVN
IVLTAQQNFSREGVIVVHSLEELDRVLAGYDSDSIYIIGGESVYRQLKDRCDTAYVTRID
YAYDADAWFPDLDADPDWEVTAVSEEQIYFDLIYHFCTYKRKEKEAGSHE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaattgcagcagcagacaaaaactggggaatcggcaaaaataaccagctgctg
gtttcgattccggaagacatgaaatttttccgcagcaccaccatgaacggcgtggttgtt
atgggacgcaggacgctggacagttttcccggcggccggccgcttccccggcgggtcaat
atcgtacttaccgcacagcagaatttttccagagaaggtgtcattgtagtgcattccctg
gaagagctggaccgggtgctggcagggtatgattcggacagcatctatatcatcggaggc
gaaagcgtttaccgtcagttgaaggaccgctgcgataccgcctatgtcacacggattgac
tacgcctatgacgcggatgcctggttcccggacctggacgcggatccggactgggaagtg
acagcagtcagcgaggagcagatctattttgatctgatctatcatttctgcacttataag
aggaaagaaaaagaagcaggcagtcatgagtaa

DBGET integrated database retrieval system