KEGG   Clostridium sp. SY8519: CXIVA_16600Help
Entry
CXIVA_16600       CDS       T01565                                 

Gene name
IspE
Definition
4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cls  Clostridium sp. SY8519
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CXIVA_16600 (IspE)
Enzymes [BR:cls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CXIVA_16600 (IspE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1796959..1797831
Genome map
AA seq 290 aa AA seqDB search
MDTVSLKALAKINLGLDVVGEREDGYHEVRMVMQSIHLYDRVEIRRTRSPQIKVETNLYY
LPVDEDNLVYKAAKYMKEAFDIKEGVRITLQKFIPVAAGLAGGSSDAAAVLVGMNKLFKL
GARQEQLMEIGARIGADVPFCVMRGTVLAEGIGEKLTPLSQMPRYPILIAKPGISVSTKT
VYDNLKLSEGMHHPDIDGLIAAIESRDLDQIAGKMENILETVTVPRYPVINEIKKVMLDH
GARIAMMSGSGPSVFGIFPNEKEIRKAYEALKACDFVKNLYTSEIHNNRR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacacagttagtttaaaagcactggccaagatcaaccttggcctggacgtagtcggt
gagcgggaggacggctatcacgaagtacgtatggtgatgcagtcgattcacttatatgac
cgggtggagatcagacgcaccagatctccgcagattaaggtagagacgaatttgtactat
ctgccggtggatgaggataatctggtatacaaagcagcaaaatacatgaaagaggccttt
gatattaaggaaggcgtgcgcatcactctccagaagtttattcccgtggctgcgggtctg
gccggcggcagctctgacgcggcagccgtgctggtaggcatgaataagcttttcaaactg
ggcgcccgacaggagcagctgatggagatcggcgcgcggatcggcgcggatgtgccgttc
tgcgtaatgcggggaaccgtgctggcagagggaatcggcgagaagctgacccccctgtcc
cagatgccccgctatccgatcctgatcgccaagccggggatttcagtatctaccaagacg
gtatatgacaacttaaaactcagcgaagggatgcaccatccggatatcgacggcctgatt
gccgctattgagtccagggatctggatcagatcgccggcaagatggagaatattctggaa
acggtgacagttcccaggtatccggtcatcaatgaaattaaaaaagtgatgctggaccac
ggcgcccgcatcgcgatgatgagcggcagcggtccgtccgtattcggcattttcccgaat
gaaaaggagattcgcaaggcatacgaggccctgaaggcgtgcgatttcgtcaagaacctc
tatacttctgagatccataacaaccgtcgataa

DBGET integrated database retrieval system