KEGG   Clostridium sp. SY8519: CXIVA_16600Help
Entry
CXIVA_16600       CDS       T01565                                 

Gene name
IspE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00900  Terpenoid backbone biosynthesis
cls01100  Metabolic pathways
cls01110  Biosynthesis of secondary metabolites
cls01130  Biosynthesis of antibiotics
Module
cls_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CXIVA_16600 (IspE)
Enzymes [BR:cls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CXIVA_16600 (IspE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAK47626
UniProt: F7V4E7
Position
1796959..1797831
Genome map
AA seq 290 aa AA seqDB search
MDTVSLKALAKINLGLDVVGEREDGYHEVRMVMQSIHLYDRVEIRRTRSPQIKVETNLYY
LPVDEDNLVYKAAKYMKEAFDIKEGVRITLQKFIPVAAGLAGGSSDAAAVLVGMNKLFKL
GARQEQLMEIGARIGADVPFCVMRGTVLAEGIGEKLTPLSQMPRYPILIAKPGISVSTKT
VYDNLKLSEGMHHPDIDGLIAAIESRDLDQIAGKMENILETVTVPRYPVINEIKKVMLDH
GARIAMMSGSGPSVFGIFPNEKEIRKAYEALKACDFVKNLYTSEIHNNRR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacacagttagtttaaaagcactggccaagatcaaccttggcctggacgtagtcggt
gagcgggaggacggctatcacgaagtacgtatggtgatgcagtcgattcacttatatgac
cgggtggagatcagacgcaccagatctccgcagattaaggtagagacgaatttgtactat
ctgccggtggatgaggataatctggtatacaaagcagcaaaatacatgaaagaggccttt
gatattaaggaaggcgtgcgcatcactctccagaagtttattcccgtggctgcgggtctg
gccggcggcagctctgacgcggcagccgtgctggtaggcatgaataagcttttcaaactg
ggcgcccgacaggagcagctgatggagatcggcgcgcggatcggcgcggatgtgccgttc
tgcgtaatgcggggaaccgtgctggcagagggaatcggcgagaagctgacccccctgtcc
cagatgccccgctatccgatcctgatcgccaagccggggatttcagtatctaccaagacg
gtatatgacaacttaaaactcagcgaagggatgcaccatccggatatcgacggcctgatt
gccgctattgagtccagggatctggatcagatcgccggcaagatggagaatattctggaa
acggtgacagttcccaggtatccggtcatcaatgaaattaaaaaagtgatgctggaccac
ggcgcccgcatcgcgatgatgagcggcagcggtccgtccgtattcggcattttcccgaat
gaaaaggagattcgcaaggcatacgaggccctgaaggcgtgcgatttcgtcaagaacctc
tatacttctgagatccataacaaccgtcgataa

DBGET integrated database retrieval system