KEGG   Clostridium sp. SY8519: CXIVA_17090Help
Entry
CXIVA_17090       CDS       T01565                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cls  Clostridium sp. SY8519
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CXIVA_17090
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CXIVA_17090
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CXIVA_17090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848184..1850355
Genome map
AA seq 723 aa AA seqDB search
MPNYDINDILNQPDNQMHLYGYCGKIVRINLTTQKISYVNTYKYVPKYIGGRILINRIFW
DEVKPGAGAFDEENKFIYMTGPSTGTGIPASGRSAACSVGASINPEQYCWGNIGGWFATE
LKYAGYDGFIIEGKAQKPTYLKIEDDKIEFLPADDLWGLRVHQTQQKLEEEHGHFFKSMV
IGPAGENLVRIATITTSNDCVFGKGGFGAVWGSKNLKAVTVHGTGVVAPADIEHLKYLRL
HMNHPYMRPSPVLHCDEIGVPGAEFKVKYDRGNVACSPGCNQHCNALLLNGKSAFGKERQ
NHIEKCVSICTFVYQTDIPGSVGMFWPTKQNYVAPCKLLSREFPEPDFSDPDFEGQAQVI
PPDILNFWSADYDRGTIVNDLCNEYGIDKWEVVIWIMTWLSMCKQEHLLDDTDLGCGMPV
DVENEQFMRTFLTNLVYRKGRYGDLFAEGMSRAIRRLGYDRFSESIYHNRYSQVLNNQRI
DLPVSLEAAWGQAVHWQGRGYEGAIDKPTWLAMNLMDMLSTRDALTVEHFHCKYEYHDKA
LKDPYHCPEVIDAVNHSQNCADIKDSVMSCEWQSPDLWWPSMEAEMYSTATGYHMSAEEL
NDAASRSRLLFRAILIRNYGRTRRKEMEQIWRIIRVPDSWNEIADWEQWNEFVDMYYESR
GWDLETGWPYRETYEKYGLKDVADEMEQLGYLPKRPEKRWHDYGEAPFVQFEENRKKEGA
AIE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgccgaattatgatatcaatgatattttaaatcagccggacaatcagatgcatttatac
ggatactgcgggaaaattgtccgcatcaacctgacaacgcagaaaatcagttatgtaaat
acctacaaatatgtgccgaaatatatcggcggaaggatcctgataaaccggattttctgg
gatgaagtgaaaccgggagccggcgcgtttgacgaagagaacaagtttatctacatgacc
ggcccttcgacaggaacaggtattccggccagcgggcgaagcgctgcctgcagcgtaggc
gccagtatcaatccggagcagtactgctggggcaatatcggcggatggtttgccacggag
ctgaaatatgccgggtatgacggctttattattgaaggaaaggcgcaaaaaccgacctac
ctgaaaatcgaagatgacaagatagaatttcttcctgcggatgatctctggggactgcgt
gttcatcagacccagcagaagctggaagaggaacacgggcatttctttaaatcaatggtc
ataggaccggcaggcgaaaatctggtccgcatcgctaccataaccaccagcaatgactgt
gtatttggaaaaggcgggttcggggcagtctggggcagcaaaaacctcaaggcggtcacc
gttcatggaacgggagtggtggctccggctgacattgagcatctgaaatacctccgtctg
catatgaaccatccgtacatgcggccgtcgccggttctgcactgtgatgagatcggcgtg
cccggggcagagtttaaagtgaagtatgaccgcggaaatgtggcctgcagccccgggtgc
aaccagcactgcaacgcgcttctgcttaatgggaaaagcgcctttggaaaagagcgtcag
aatcatattgagaaatgtgtcagcatctgcacctttgtctatcagacagatattccagga
agtgtgggaatgttctggcccacaaaacagaactatgttgcgccctgtaagctcctgagc
agagagtttccggaaccggatttttctgatccggattttgagggacaggcccaggtaatt
ccgccggatatcctgaatttctggagcgcggattatgaccggggaaccattgtcaacgat
ctctgcaatgaatatggaatcgataagtgggaagtggtcatctggataatgacctggctt
tccatgtgtaagcaggaacatctgctggatgacaccgatctgggctgcggcatgccggta
gatgtggaaaatgagcagttcatgcggacgtttcttaccaatcttgtgtatcggaagggt
agatacggggatctttttgcggagggaatgtcaagagccatccggaggcttggatacgac
cgtttcagtgaaagcatctatcataaccggtattcccaggtgctgaacaaccagagaatc
gatcttcccgtgagcctggaggcggcctggggacaagctgtgcactggcagggcagaggc
tatgaaggggccattgacaaacccacctggcttgcgatgaatctgatggatatgctttcc
acgcgggatgcgctgactgtagagcattttcactgcaaatatgaatatcatgacaaggcg
ctgaaggatccttatcactgtccggaagtaattgacgcagtcaatcacagccagaactgc
gcggatatcaaggactccgtgatgagctgtgaatggcagagtccggatttgtggtggccg
tcgatggaagctgagatgtacagcacggctaccggttatcacatgtcagcggaagaactg
aatgacgcggccagtcgttccagactgcttttccgggcgatcctgatccgcaattacgga
cggacaagacgcaaagaaatggaacagatctggcggatcatccgtgtcccggattcctgg
aatgagattgcggactgggaacagtggaatgaatttgtggacatgtattatgaaagcagg
ggctgggacctggaaaccggctggccttaccgcgagacctacgaaaaatacggactcaag
gatgtggcggatgaaatggagcagctgggatacctgccaaagcgaccggaaaaacgctgg
catgattacggggaagctccatttgtacagttcgaagagaaccggaaaaaagaaggggca
gccattgagtag

DBGET integrated database retrieval system