KEGG   Clostridium sp. SY8519: CXIVA_17380Help
Entry
CXIVA_17380       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cls  Clostridium sp. SY8519
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CXIVA_17380
Enzymes [BR:cls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CXIVA_17380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1883808..1884515
Genome map
AA seq 235 aa AA seqDB search
MEQNYQKERAAVTDVCHKLWQRGIVAANDGNVSVKLDENHFLCTPSGVSKIDITPDMLVE
VDGSGQVLYAKDGLKPSSEMKMHFRCYEKRKDVRAVVHAHPPVSTSYASMERALDGYQIM
ESIVNLGAVPVAPYARPSSDQVPDSITPYLEHHDAILLAHHGALTLGDCLQTAYFRMETL
EMTAKMSLCIHLLGGEKDLPREKIDELIDLRENGYRLTGRHPGYVKYNSTEEIGE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaactatcagaaagaaagagcggcagtgacggatgtctgccataaattatgg
cagaggggaatcgtcgcggcaaatgacggaaatgtgtccgtgaaactggatgagaatcat
ttcctctgcacgccttccggtgtcagcaagatcgatattacaccggatatgctggtggaa
gtcgatggaagcggacaggtgctgtacgcaaaggacggcttaaaaccttcctccgaaatg
aaaatgcacttccgctgttatgagaagagaaaggatgtcagggcagtggtacacgcccat
ccgccggtgtctaccagctacgcgtccatggaacgggcgctggacggctatcagattatg
gaatccatcgtcaatctcggcgccgttccggtggcgccctacgcgcgtccctcttcggac
caggtgccggattccattaccccgtatctggaacaccatgacgcgattctgctggcccat
cacggcgccctgacgctgggagactgtctgcagaccgcatatttccgtatggagacactg
gaaatgacagcgaagatgtctctttgcatccatttgctgggcggcgagaaggatctgccc
agggaaaaaattgacgaactgatcgacttaagagagaacgggtaccgcctgaccggacgg
catccgggttatgtaaaatataacagcacagaggaaatcggcgaatga

DBGET integrated database retrieval system