KEGG   Clostridium sp. SY8519: CXIVA_19900Help
Entry
CXIVA_19900       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cls  Clostridium sp. SY8519
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CXIVA_19900
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CXIVA_19900
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CXIVA_19900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2150689..2151231)
Genome map
AA seq 180 aa AA seqDB search
MAFYDYKVMDRNGEELSLKEYEGKVVLVVNTATGCGFTPQYKDLETMYEAFHDRGLEILD
IPCNQFAGQTPGTDEEIHEFCTLKYNTQFPQMKKSEVNGPNALPLYTYLKSQQGFKGFGK
GPKAVMMGAMLHKIDKDYKNNPEIKWNFTKFLVDRNGAVVARFEPTESMEKVSAAVEKLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggctttttatgattacaaagtaatggaccgtaatggagaagaattatctttaaaagaa
tatgaaggcaaagtagtactggtagtaaatacagcgaccggatgcggatttactccccag
tacaaagatctggaaaccatgtatgaagcttttcacgaccgcgggctggagatcctggat
atcccctgcaaccagtttgcaggccagacgccgggaaccgatgaggaaattcacgaattc
tgcacactgaaatacaatactcagtttccgcagatgaagaagtctgaggttaacgggccg
aatgcccttcccctctatacatatctgaagagccagcagggcttcaaaggctttggcaaa
ggtccgaaagcggttatgatgggcgcaatgctccacaagattgataaagattacaagaac
aatccggagatcaaatggaatttcacaaaattcctggttgaccgaaacggcgctgtcgtt
gctcgtttcgaaccgacagaaagcatggaaaaggtttccgccgcagtggaaaaactgctg
taa

DBGET integrated database retrieval system