KEGG   Clostridium sp. SY8519: CXIVA_19900Help
Entry
CXIVA_19900       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00480  Glutathione metabolism
cls00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CXIVA_19900
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CXIVA_19900
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CXIVA_19900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAK47957
UniProt: F7V5C8
Position
complement(2150689..2151231)
Genome map
AA seq 180 aa AA seqDB search
MAFYDYKVMDRNGEELSLKEYEGKVVLVVNTATGCGFTPQYKDLETMYEAFHDRGLEILD
IPCNQFAGQTPGTDEEIHEFCTLKYNTQFPQMKKSEVNGPNALPLYTYLKSQQGFKGFGK
GPKAVMMGAMLHKIDKDYKNNPEIKWNFTKFLVDRNGAVVARFEPTESMEKVSAAVEKLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggctttttatgattacaaagtaatggaccgtaatggagaagaattatctttaaaagaa
tatgaaggcaaagtagtactggtagtaaatacagcgaccggatgcggatttactccccag
tacaaagatctggaaaccatgtatgaagcttttcacgaccgcgggctggagatcctggat
atcccctgcaaccagtttgcaggccagacgccgggaaccgatgaggaaattcacgaattc
tgcacactgaaatacaatactcagtttccgcagatgaagaagtctgaggttaacgggccg
aatgcccttcccctctatacatatctgaagagccagcagggcttcaaaggctttggcaaa
ggtccgaaagcggttatgatgggcgcaatgctccacaagattgataaagattacaagaac
aatccggagatcaaatggaatttcacaaaattcctggttgaccgaaacggcgctgtcgtt
gctcgtttcgaaccgacagaaagcatggaaaaggtttccgccgcagtggaaaaactgctg
taa

DBGET integrated database retrieval system