KEGG   Clostridium sp. SY8519: CXIVA_20460Help
Entry
CXIVA_20460       CDS       T01565                                 

Gene name
PorA
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CXIVA_20460 (PorA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_20460 (PorA)
   00020 Citrate cycle (TCA cycle)
    CXIVA_20460 (PorA)
   00620 Pyruvate metabolism
    CXIVA_20460 (PorA)
   00640 Propanoate metabolism
    CXIVA_20460 (PorA)
   00650 Butanoate metabolism
    CXIVA_20460 (PorA)
  Energy metabolism
   00680 Methane metabolism
    CXIVA_20460 (PorA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CXIVA_20460 (PorA)
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CXIVA_20460 (PorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2207580..2208785
Genome map
AA seq 401 aa AA seqDB search
MAENKQVCRPISERLSGNEAVAYAIRQVNPDVMPAFPITPSTEIPQMVSTYIANGQMETE
FIPVESEHSAMSAAIGASAAGARTMTATSSAGLALMWEELLMAASNRLPIVLTLVNRTLS
GPININCDHTDGMGARDTGWIQIYAENNQEVYDNYIQAFRIAEHKDVHLPIMICQDGFIT
SHAVQNISLMPDEPVREFVGTYEPEEFLLNPHRPVSAGPYAETDFVMEARKNQRQAMENA
KQVILDVGREYGGISGREYGLFEAYRTEDADCIMLLMGSAAGTAKEAVDELREQEKKVGV
LKLRVFRPFPAEEIAEVLKGAKAAAILDRSESYSGGAGVLGSEVMAALYRAHADTLAVNY
VYGLGGRDFTTADAAGVFAELEEALTGGTEIPQYQYIGLRQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaagcaggtatgcagaccgatttcggagcggttatccggaaatgaagca
gtggcgtatgccatccgtcaggtaaatcccgatgtgatgccggcgtttcccatcacgccc
tccacggagattccccagatggtgtccacctatatcgccaacggacagatggagacagaa
tttatcccggtggaaagcgagcattctgccatgagcgctgccatcggcgcctccgctgcc
ggtgcccgtaccatgacggccacatcctccgccgggctggcgctgatgtgggaggaactg
ctgatggcagcttccaatcggctgccgatcgtcctaaccctggtgaaccgcaccctgtcc
gggccgatcaacatcaactgcgaccatacggacggcatgggagcccgggataccggctgg
atccagatctatgcggaaaacaatcaggaagtctatgataattatatccaggccttccgg
attgcggagcataaagatgtgcacctgcccattatgatctgccaggacggatttatcacc
agtcacgcggtgcagaatatcagcctgatgccggacgaaccggtgcgggagtttgtggga
acttatgaaccggaagaatttctgctgaatccgcaccggccggtatccgcaggaccgtac
gcagagacggattttgtgatggaagcgcggaaaaaccagcggcaggccatggaaaatgcc
aaacaggtgattctggatgtgggccgggaatacggcgggatttccggcagggaatatggc
ctgtttgaggcctaccgcacggaggacgcggactgtatcatgcttttgatgggatccgcg
gccgggactgccaaagaagcagtggatgaactgcgggaacaggagaaaaaggtcggcgtg
ctgaagctgagggtattccggccgtttccggcagaagaaattgcggaagtattaaaaggc
gcaaaggcggcagcgattctggaccgttcggaaagctacagcggcggagccggcgtgctt
ggaagcgaagtcatggctgccctgtaccgggcccatgcggataccctggcggtaaattac
gtatacggcctgggcggccgggactttaccaccgctgacgctgccggcgtgtttgcggag
ctggaagaggcgctgaccggcggcacagagatcccgcagtaccagtatatcggattgaga
cagtag

DBGET integrated database retrieval system