KEGG   Clostridium sp. SY8519: CXIVA_20470Help
Entry
CXIVA_20470       CDS       T01565                                 

Gene name
PorB
Definition
pyruvate:ferredoxin oxidoreductase
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CXIVA_20470 (PorB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_20470 (PorB)
   00020 Citrate cycle (TCA cycle)
    CXIVA_20470 (PorB)
   00620 Pyruvate metabolism
    CXIVA_20470 (PorB)
   00640 Propanoate metabolism
    CXIVA_20470 (PorB)
   00650 Butanoate metabolism
    CXIVA_20470 (PorB)
  Energy metabolism
   00680 Methane metabolism
    CXIVA_20470 (PorB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CXIVA_20470 (PorB)
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CXIVA_20470 (PorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2208801..2209742
Genome map
AA seq 313 aa AA seqDB search
MASYNFKEVMSKPERFSPGHRMCPGCGAPLAVRAVLRALHEEDQAVIANATGCMEVSTFM
YPYTAWEDSYIHNAFENAGATLSGVETAYRALRKRGRLPQQERFKFIAFGGDGGTYDIGF
QSLSGAMERNHDLVYVCYDNGAYMNTGIQRSSATPMFADSTTTPVGTESNGKLQPRKDLT
AIIADHRVPYVAQTTFLGNFSDIHRKAEKAIYTEGAAFLNVMAPCPRGWRYETGDLMKIC
RLAADTCYWPLFEVEQDRWRLTYEPKKKLPVEDFLRSQGRFRHLFRPENEHLIEQFQKEV
DRRWEDLLYQCAR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtataattttaaagaagtaatgagcaaaccggagcgcttctccccgggacac
agaatgtgtccgggctgcggcgccccccttgcggtccgtgcggtcctgcgggccctgcat
gaagaggatcaggcagtgattgccaatgccaccggctgtatggaagtgtccaccttcatg
tatccgtatactgcgtgggaagacagctatatccacaatgcctttgagaatgcgggcgca
actttaagcggtgtggagactgcttaccgtgcgctgcgaaaacggggaagactgccgcag
caggagcggtttaaatttattgccttcggcggggacggcggcacctatgatatcgggttc
cagtccctgtccggagccatggagcgcaaccatgatctggtttatgtgtgttatgacaac
ggcgcttatatgaataccggtatccagcgttcctcggcgactccgatgtttgcggattcc
accaccacaccggtgggcacagaatccaacggaaaactgcagcccagaaaggatctgacg
gcgattattgcggaccatcgggttccttatgtggcgcagactacattcctgggaaacttc
agcgatattcacagaaaagcggaaaaagccatttatacagaaggcgcggcttttttaaat
gttatggctccctgcccgcggggatggcgctatgagaccggggatctgatgaaaatctgc
cggcttgcggcagatacctgctactggccgctgtttgaagtggagcaggaccggtggcgc
ctgacctatgaaccgaagaaaaagcttccggtggaagacttcctccggtcacagggaagg
ttccggcatttgttccggccggaaaatgaacatctgatagaacagttccagaaagaagtg
gacaggcgctgggaggatctgctgtatcaatgcgcgcggtaa

DBGET integrated database retrieval system