KEGG   Clostridium sp. SY8519: CXIVA_20470Help
Entry
CXIVA_20470       CDS       T01565                                 

Gene name
PorB
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CXIVA_20470 (PorB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_20470 (PorB)
   00020 Citrate cycle (TCA cycle)
    CXIVA_20470 (PorB)
   00620 Pyruvate metabolism
    CXIVA_20470 (PorB)
   00640 Propanoate metabolism
    CXIVA_20470 (PorB)
   00650 Butanoate metabolism
    CXIVA_20470 (PorB)
  Energy metabolism
   00680 Methane metabolism
    CXIVA_20470 (PorB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CXIVA_20470 (PorB)
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CXIVA_20470 (PorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2208801..2209742
Genome map
AA seq 313 aa AA seqDB search
MASYNFKEVMSKPERFSPGHRMCPGCGAPLAVRAVLRALHEEDQAVIANATGCMEVSTFM
YPYTAWEDSYIHNAFENAGATLSGVETAYRALRKRGRLPQQERFKFIAFGGDGGTYDIGF
QSLSGAMERNHDLVYVCYDNGAYMNTGIQRSSATPMFADSTTTPVGTESNGKLQPRKDLT
AIIADHRVPYVAQTTFLGNFSDIHRKAEKAIYTEGAAFLNVMAPCPRGWRYETGDLMKIC
RLAADTCYWPLFEVEQDRWRLTYEPKKKLPVEDFLRSQGRFRHLFRPENEHLIEQFQKEV
DRRWEDLLYQCAR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtataattttaaagaagtaatgagcaaaccggagcgcttctccccgggacac
agaatgtgtccgggctgcggcgccccccttgcggtccgtgcggtcctgcgggccctgcat
gaagaggatcaggcagtgattgccaatgccaccggctgtatggaagtgtccaccttcatg
tatccgtatactgcgtgggaagacagctatatccacaatgcctttgagaatgcgggcgca
actttaagcggtgtggagactgcttaccgtgcgctgcgaaaacggggaagactgccgcag
caggagcggtttaaatttattgccttcggcggggacggcggcacctatgatatcgggttc
cagtccctgtccggagccatggagcgcaaccatgatctggtttatgtgtgttatgacaac
ggcgcttatatgaataccggtatccagcgttcctcggcgactccgatgtttgcggattcc
accaccacaccggtgggcacagaatccaacggaaaactgcagcccagaaaggatctgacg
gcgattattgcggaccatcgggttccttatgtggcgcagactacattcctgggaaacttc
agcgatattcacagaaaagcggaaaaagccatttatacagaaggcgcggcttttttaaat
gttatggctccctgcccgcggggatggcgctatgagaccggggatctgatgaaaatctgc
cggcttgcggcagatacctgctactggccgctgtttgaagtggagcaggaccggtggcgc
ctgacctatgaaccgaagaaaaagcttccggtggaagacttcctccggtcacagggaagg
ttccggcatttgttccggccggaaaatgaacatctgatagaacagttccagaaagaagtg
gacaggcgctgggaggatctgctgtatcaatgcgcgcggtaa

DBGET integrated database retrieval system