KEGG   Clostridium sp. SY8519: CXIVA_22040Help
Entry
CXIVA_22040       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cls  Clostridium sp. SY8519
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CXIVA_22040
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CXIVA_22040
Enzymes [BR:cls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CXIVA_22040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2407991..2408815
Genome map
AA seq 274 aa AA seqDB search
MILDDIVEKKQIRLKEHKSRIHPAEMIRLADEAQASGGNFYQALKKPGISIIGEFKKASP
SLGKIRQTMELTDRIDEYNRAVDCISCLTEEDYFLGSTEYLRQIRGISPLPILRKDFMID
PYQFYEAKAIGADAILLITGILDDAQLKDFYQLSEELGLDALFEAHTEEQMDRTLNCGAK
IVGVNNRDLRDFSIHLETTERLASMVPEDRVFVAESGIVQDEDVRLLARCRVDAFLIGRA
FMESRHPEAVAKHWKEVYLEAKKAIGPQGGNRMP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatattggatgacattgttgaaaagaagcagatacgcctgaaggaacacaaatccaga
atccatccggcagagatgatacggctggcggatgaggcgcaggcgtccggagggaatttt
taccaggcactgaaaaagccgggaatctccattatcggcgagtttaagaaggcatcgccg
agtctgggaaaaatccggcagaccatggagctgaccgaccgcattgatgaatacaaccgc
gcggtggactgcatctcctgcctgacggaagaagattatttccttggcagcactgaatat
ctccgccagattcgcggaatatcccccctgccgattctgcgcaaggattttatgatcgat
ccctatcagttttatgaggcaaaggcaatcggcgcggacgcgattcttctgattaccgga
attctggatgatgcgcagctgaaggatttttatcagctgtcggaagaactgggactggat
gcgttatttgaggcgcataccgaagaacagatggaccggacactgaactgcggggcaaaa
atcgtcggtgtcaacaaccgggatctgcgggatttttccattcatctggaaaccacggag
cgtctggcttccatggtgcctgaggaccgggtctttgtggcagagagcgggattgtgcag
gatgaagatgtgcggcttctggccagatgccgggtggatgcgttcctcatcggaagggca
tttatggaatcccgtcatccggaagccgtggcaaagcactggaaagaagtttatctggaa
gcaaaaaaagccatagggccgcagggcgggaaccggatgccatga

DBGET integrated database retrieval system