KEGG   Clostridium sp. SY8519: CXIVA_22050Help
Entry
CXIVA_22050       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CXIVA_22050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CXIVA_22050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CXIVA_22050
Enzymes [BR:cls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CXIVA_22050
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CXIVA_22050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2408812..2410677
Genome map
AA seq 621 aa AA seqDB search
MKQVKIKICGITTEEDVKWINQYQPEYAGFVYYPKSRRHISLDRMKQLMRLTAPEIRKVA
VCVEPSAEEAKALEACGADLIQIHGRLDPDLPEAVHVPLWHAVNIQPEMDRIPDPDPKIS
GYVADGSRYGGGKTFDWKDNAGIFDRFRRNFREQRPEEKEPELILAGGLNPSNVTAGIRM
FHPDIVDVSSGVESPGRPGKDPELIRQFIHTVRALNQKGSTMKKSSMREHAYIGEFGGQY
VAETLMNTLEELNDAFEEAIHDPEFMKEYHYYLDEYVGRATPLYYAERLSEKYGTKIYLK
REDLDHTGAHKINNVIGQILLAKRMGKTKVIAETGAGQHGVATATGAALFNMKCTVYMGK
EDMERQALNVFRMRLLGADVVSVESGSNTLKDATNEAIRTWAKTAEDTFYIIGSAVGPYP
YPKMVKEFQRVISTEARAQHLEKEGRLPDVVMACVGGGSNSIGMFADFIDDRDVQLIGVE
AAGRGIETGEHAAAFADGTPGTLHGMRSYLLQDEDGNIKLAHSISAGLDYPGVGPEHAYL
RDSGRAQYVSITDAEAMDALMELTRVEGIIPAIESAHAMAYAFKKAKEMTMDQSMIVCLS
GRGDKDINTIVNYVEGKGYQN
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggtcaaaattaaaatctgcgggatcacaacggaagaagatgtaaagtggatc
aatcagtatcagccggagtatgccggctttgtctattatcccaaaagccggcggcatatt
tcgctggaccgcatgaaacagctgatgcggctgaccgcaccggaaatccggaaagtggcg
gtatgcgtagaaccttctgcagaggaagcaaaggctcttgaggcctgcggcgcggatctg
atccagattcacggcagactggacccggacttgccggaagcagtccacgtgccgctgtgg
cacgcagtgaatattcagccggaaatggaccggataccggatccggatccgaaaatatcc
ggttacgtggcagacggatcccggtatggcggcggaaagacctttgactggaaggacaat
gccgggatttttgaccggttccgcagaaatttccgggaacagcggccggaagaaaaagaa
ccggaactgattcttgcgggagggctgaatccttccaacgtgacagcaggaatccggatg
ttccacccggatattgtggatgtaagcagcggcgtggagtctcccggacggccgggaaaa
gacccggagctgatccggcagtttattcatacagtacgagcattaaatcagaaaggaagt
accatgaagaaatcatcaatgagagagcatgcatatatcggagaattcggcggtcagtat
gtggcggaaacgctgatgaacaccctggaagaattgaatgatgcctttgaagaagccatt
catgatccggaatttatgaaggaatatcattactatctggacgaatatgtgggacgggca
acccctctgtattacgccgagcggctcagtgaaaaatacggaacaaaaatctacctaaaa
cgggaagacctggaccataccggcgcccacaaaattaacaatgtgatcggtcagatcctt
ctggcaaaacggatgggcaaaaccaaggtaatcgcggaaacaggcgccggccagcacggc
gtagccacagccaccggcgcggcgctgtttaacatgaaatgtaccgtatacatgggaaag
gaagacatggaacggcaggcattaaatgtattccgtatgcgcctgctgggagctgacgtg
gtcagtgtggaatccggcagcaacacattaaaagacgccaccaatgaagcgatccgcacc
tgggccaagacagcggaagatacattttatatcatcggatccgcagtggggccctatccg
tatcctaagatggtgaaagagtttcagcgggtcatcagtacggaagccagggcacagcac
ctggaaaaggaaggccgtcttccggacgtggtaatggcttgtgtgggcggcggctccaac
tccatcggcatgtttgcggatttcattgatgacagggatgtgcagctgattggtgtggaa
gctgccggcagaggaattgagaccggagaacacgcagcggcattcgcggacgggacaccg
ggcacgctgcatggcatgcgttcttatctgctgcaggacgaagacggcaatattaagctg
gcccattcgatttccgccggactggattacccgggcgtcggaccggaacatgcctatctg
agagacagcggacgcgcccagtatgtgtcaattacggacgcggaagccatggacgccctg
atggaactgacccgggtcgaaggaattattccggccatcgagagtgcccacgcaatggcc
tatgccttcaaaaaggcgaaggagatgacgatggatcagtccatgattgtctgcctgtcc
gggcgcggagataaagatatcaatacaattgtcaattatgtagaaggaaaaggatatcag
aattag

DBGET integrated database retrieval system