KEGG   Clostridium sp. SY8519: CXIVA_22060Help
Entry
CXIVA_22060       CDS       T01565                                 

Definition
chloride channel protein EriC
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CXIVA_22060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CXIVA_22060
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CXIVA_22060
Enzymes [BR:cls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CXIVA_22060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2410689..2411474
Genome map
AA seq 261 aa AA seqDB search
MNRIEEKFQQLKKEQKKAFVTYITAGLPDMERCKELIKAQEEAGLDVLELGVPFSDPVAD
GPVIQDASFRSIQKGTSLRKCFDLVEKVRKEGVELPIVFMMYYNTITHYGLEEFARKCNE
TGVDGLLVPDLPMEEQGPLKEVLGDRDETILLQLVSPVSAGRIPEILQDARGFVYCVSSM
GVTGQAADFHKSVLSYLKDVKQQSSIPVLMGFGIRTPQDVAPMKEIIDGAIVGSHFINLM
EQNNYDLDTARNYIREFKAGF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaattgaagaaaaatttcagcagctgaaaaaggagcagaagaaagcgttcgtt
acctatattactgcaggacttccggatatggaacgctgcaaagaactgatcaaagcccag
gaagaggcgggactggatgtgctggaactgggcgttcctttttccgatccggttgctgac
ggacctgtgatccaggatgcttctttccggtccatccagaagggcacctctttgcgaaag
tgttttgatctggtggaaaaagtcagaaaagagggcgtggaactcccgattgttttcatg
atgtactataacaccataacacactacggtctggaggaatttgccagaaagtgcaatgag
acaggcgtggacggactgctggttccggatcttccgatggaagagcagggaccgttaaag
gaagtgctgggagaccgggacgaaacgattttgctgcagctggtttccccggtttccgcg
gggcggattccggagattcttcaggatgcccggggatttgtttactgtgtgtcttccatg
ggagttaccggtcaggcagcagatttccacaaatccgttctgtcctatctgaaggacgta
aagcagcagtcttcgattccggtgttaatgggattcggaatccggacgccgcaggatgtg
gcaccaatgaaagagatcatcgacggcgcgattgtcggttctcactttatcaatctgatg
gaacagaacaattacgacctggataccgcacggaattatatccgggaatttaaggcggga
ttctga

DBGET integrated database retrieval system