KEGG   Clostridium sp. SY8519: CXIVA_22920Help
Entry
CXIVA_22920       CDS       T01565                                 

Gene name
Gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cls  Clostridium sp. SY8519
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CXIVA_22920 (Gmk)
Enzymes [BR:cls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CXIVA_22920 (Gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2496848..2497486)
Genome map
AA seq 212 aa AA seqDB search
MSQQGILTIISGFSGSGKGTIVRELMAQHPDEFALSISATTRAPREGEKEGVSYFFKSRE
AFEQMILQDELLEYAQYVDNYYGTPRAYVDRQLAAGKNVILEIEVQGAMKIREKYPDTLL
LFVTPPSAEELKQRLVGRDTETAEVILSRLSRAYEEADGCEAYDYLVINDQLDACVRQVY
DLIQNEKHRMVYNMDRIHRIKEELRAFSKGEH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacagggaattttaactattatatccggattttccggatccggaaaaggcaca
attgtcagggagctgatggcacagcatccggatgaattcgccctttccatttcagcaacc
acaagagctccccgggaaggggaaaaagagggcgtttcctattttttcaagagccgggaa
gcgtttgaacagatgattctgcaggatgaactgctggagtacgcgcagtatgtcgataat
tattacgggactccccgcgcgtatgtggaccggcagctggcagcgggaaaaaatgtgatc
ctggaaatagaagtgcagggcgcaatgaaaatccgggagaaatatcccgatacccttctg
ctttttgtaacgcctccttccgcggaagagctgaagcagcgtctggtgggaagagacacc
gagacggcggaggttattctgtcgcggcttagccgggcctatgaagaagctgacggatgt
gaagcctatgattatctggtgatcaacgatcagctggatgcctgtgtcagacaggtctat
gatctgattcagaatgaaaagcaccgcatggtttacaatatggacagaatccacagaatc
aaagaagaactcagagcattttcgaaaggagaacactga

DBGET integrated database retrieval system