KEGG   Clostridium sp. SY8519: CXIVA_23090Help
Entry
CXIVA_23090       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cls  Clostridium sp. SY8519
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cls00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CXIVA_23090
Enzymes [BR:cls01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CXIVA_23090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2514119..2514736)
Genome map
AA seq 205 aa AA seqDB search
MYAYIKGTLEETAADHIVVDNHGIGYNIQVSGRILDQLPALGEPVKLYTYTNVREDSFTL
FGFLNREDVNLFRMLITVSGIGPKGGLAILSVFSADELRFAVLSGDDKTIARAPGIGKKT
AQRLIIELKDKIHPEDILPDTDAEAPADAAVADSRSRQRSEASMALVALGYSASDAARIL
SQISISDDSDTETILKEALKRLSTL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtatgcatacattaaaggcacgctggaagaaacggctgctgaccatattgttgtagat
aatcacggaatcggctacaatatacaggtatccgggagaattctggatcagctgcctgcg
ctgggcgaaccggtgaagctgtatacctataccaatgtgcgggaagacagcttcacgctg
tttgggtttttaaaccgtgaagatgtgaatctgtttcgtatgctgatcacagtcagcgga
atcggtccgaaaggaggactggcgattctctctgttttctcggcggatgaactgcgcttc
gcagtcctgagcggggacgacaagacgattgcgcgggcgcctgggatcggcaaaaaaaca
gcccagaggctgattattgaactgaaagacaaaatacacccggaggatattctgcccgat
acagatgcggaagcgcctgcggatgctgccgttgcagacagcagatcccggcagcggtcc
gaggcatccatggccctggtggctctggggtattccgcttctgacgccgcaaggattctg
tcccagatttccatttccgacgacagtgacacggaaacgattctgaaggaggcattaaag
cggctgtctacgttataa

DBGET integrated database retrieval system