KEGG   Clostridium sp. SY8519: CXIVA_23490Help
Entry
CXIVA_23490       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00900  Terpenoid backbone biosynthesis
cls01100  Metabolic pathways
cls01110  Biosynthesis of secondary metabolites
cls01130  Biosynthesis of antibiotics
Module
cls_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CXIVA_23490
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CXIVA_23490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAK48316
UniProt: F7V6D7
Position
complement(2555131..2556273)
Genome map
AA seq 380 aa AA seqDB search
MRKIAILGSTGSIGTQTLDVIRIHQDLQVTALSAGDNIRLLEKQIREFHPHLVSVREEKA
AKELRLAVADLDVKVVSGPEGLIETATDPQADILVTAVVGMVGILPTIAAIKAGKDIALA
NKETLVTAGHIIMPLAAEHKVSILPVDSEHSAIFQSLQGNEGNRIERILLTASGGPFRGR
TLQQLADVTAADALKHPNWSMGKKITIDSATLVNKGLEVMEAKWLFGVSEEQIEILVHPQ
SVIHSAVQYEDGAVMAQLGTPDMKIPIQYALYYPHRPHLPGKRLDLFALGALTFERPDPD
TFQGLKLAREALKAGGNVPAVFNAANEYAVALFLNGAIRFLEIPEIIESCMREIPFCENP
DVSQILAAQAQTEEFIRGRW
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgcaattttaggctccaccggttccattggaacccagacccttgatgtg
atccggatccatcaggatcttcaggttacagcgctctccgccggagacaatatccgactg
ctggaaaagcagatccgggagtttcatccgcacctggtgtctgtccgtgaggaaaaggcc
gcaaaagagctgcggctggcggtggcggatctggatgtgaaagtggtgtccggaccggaa
ggactgattgagacggcgacagacccccaggcggatattctcgtgaccgcagtcgtggga
atggtggggatcctgcccaccattgcagccataaaggccggaaaggatatcgcgctggca
aacaaggagaccctggtgaccgccggacatatcattatgcctctggcagcggaacacaag
gtttccatactgccggtagacagtgaacacagcgcaattttccagtcgctgcagggcaat
gagggcaataggatcgaacggattctcctgaccgcctccggcggccctttccgcggacgc
acactgcagcagcttgcggatgtgaccgctgcggatgcgctgaaacatccgaactggtcg
atgggaaaaaagatcaccattgattcggctaccctggtcaataagggactggaagtcatg
gaagcaaagtggctgttcggtgtgtcagaggaacagattgaaatcctggtgcatccccag
agcgtgattcattccgccgttcagtacgaagacggggcagttatggcgcagctgggcacg
ccggatatgaagataccgatccagtatgccctgtattacccgcaccggccgcatcttccc
ggaaaacgtctggacttgtttgcgttaggcgcgctgaccttcgagcgtccggatccggac
acgttccaggggctgaagcttgcgcgcgaagcgctgaaggccggcggcaatgtacctgca
gtctttaatgcagccaatgaatatgcggtggcgctgtttttaaacggagcgatccgtttt
ctggaaattccggaaatcatcgaatcctgcatgagggaaatcccgttttgcgagaatccg
gatgtttcccagattctcgcggcgcaggcgcagacagaagaattcatcagaggcaggtgg
taa

DBGET integrated database retrieval system