KEGG   Clostridium sp. SY8519: CXIVA_24060Help
Entry
CXIVA_24060       CDS       T01565                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CXIVA_24060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CXIVA_24060
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CXIVA_24060
Enzymes [BR:cls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CXIVA_24060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2617106..2618590)
Genome map
AA seq 494 aa AA seqDB search
MAILYENTRDSSEKVTASQAILNGLAGGGGLYVPTEIPRLDVPMDVLSKMTYQEVAYEVM
RRFLTDFTEEELKTCIARAYDSKFDTEEIAPLVEKDGAYYLELFHGATIAFKDMALSILP
HLMITAARKNKVTNDIVILTATSGDTGKAALAGFADVEGTRIVVFYPKNGVSPIQEKQMV
TQKGENTMVVGIHGNFDEAQTGVKKMFSDPALNAEINARGFQFSSANSINIGRLVPQIVY
YVYAYAQLIRRGAVQEGEQINVTVPTGNFGNILAAFYARCMGLPIARLLCASNENKVLFD
FFSTGTYDKNRPFILTSSPSMDILISSNLERLIYRICGNDSEKNKALMQALVTSGKYEIT
PEMREQLAVFYGNYTTEAETADVIREIYEKTGYVIDTHTAVAAKVYKKYLAETGDTKKTV
IASTASPFKFSRSVMNAIHPESVDLGDFELVDKLSELSGVKVPRAIEEIRSAPVRHKTVC
EINEMPDVVRDFLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcttatatgaaaataccagagattcatcggaaaaggtaacagcctcccaggcg
attctgaacgggctggccggcggcggcggactctatgttccgacggaaataccccgtttg
gatgtgccaatggacgttttgagcaaaatgacgtatcaggaagtggcctatgaggtaatg
cgcagatttctgacggattttaccgaagaagaattaaaaacctgcattgcccgcgcctat
gactccaagtttgacacagaagagatcgcgcctcttgtggaaaaagacggagcctattat
ctggagctgtttcacggagccacaatagcttttaaagatatggcgctgtccattctgccc
catctgatgattactgcagccagaaaaaacaaagtcaccaatgatattgtgattctgacc
gccacatccggagataccggaaaagcggccctggccggatttgctgatgtggaaggcaca
cggatcgttgtattttatccgaaaaacggtgtcagcccgattcaggaaaaacagatggtt
acccagaagggtgagaataccatggtagtgggaatccacggcaattttgacgaggcgcag
accggagtaaagaagatgttttccgatccggcattaaacgctgagatcaatgccagggga
ttccagttctcctctgccaattccatcaacatcggccgtctggttcctcagattgtatat
tatgtctatgcctatgcgcagctgatccgccggggcgcggttcaggagggagagcagatc
aatgtaacggttcccaccggcaatttcggcaacattcttgccgctttctatgcccgctgc
atgggactgcccattgcccgtctgctctgcgcttccaatgagaacaaagtgctgtttgac
tttttctccaccggcacctatgataaaaaccgaccgtttatcctgacctcttccccgtcg
atggatatcctgatttccagcaatctggagcgtctgatttaccggatctgcgggaatgat
tccgaaaagaacaaagcgctgatgcaggcgctggttaccagcggaaagtatgaaatcacc
ccggaaatgcgggagcagctggctgtcttttacgggaattacacgacggaggcggagact
gcggatgtcatccgtgagatttatgaaaagaccggatatgtcattgatacgcatacggct
gttgccgctaaagtgtataaaaagtatctggcagaaaccggggatacgaaaaaaacagtg
atcgcttccacggcaagtccgtttaagttttccagaagcgtcatgaacgccatccatccg
gaatccgtggatctgggagattttgaactggtggacaaactgtccgaactgtccggcgtg
aaagtgccgcgggcaatcgaggagatccgcagcgcgccggtacgccataagacggtatgc
gagatcaatgagatgccggatgtggtaagagattttctgaaatag

DBGET integrated database retrieval system