KEGG   Clostridium sp. SY8519: CXIVA_24060Help
Entry
CXIVA_24060       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CXIVA_24060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CXIVA_24060
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CXIVA_24060
Enzymes [BR:cls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CXIVA_24060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2617106..2618590)
Genome map
AA seq 494 aa AA seqDB search
MAILYENTRDSSEKVTASQAILNGLAGGGGLYVPTEIPRLDVPMDVLSKMTYQEVAYEVM
RRFLTDFTEEELKTCIARAYDSKFDTEEIAPLVEKDGAYYLELFHGATIAFKDMALSILP
HLMITAARKNKVTNDIVILTATSGDTGKAALAGFADVEGTRIVVFYPKNGVSPIQEKQMV
TQKGENTMVVGIHGNFDEAQTGVKKMFSDPALNAEINARGFQFSSANSINIGRLVPQIVY
YVYAYAQLIRRGAVQEGEQINVTVPTGNFGNILAAFYARCMGLPIARLLCASNENKVLFD
FFSTGTYDKNRPFILTSSPSMDILISSNLERLIYRICGNDSEKNKALMQALVTSGKYEIT
PEMREQLAVFYGNYTTEAETADVIREIYEKTGYVIDTHTAVAAKVYKKYLAETGDTKKTV
IASTASPFKFSRSVMNAIHPESVDLGDFELVDKLSELSGVKVPRAIEEIRSAPVRHKTVC
EINEMPDVVRDFLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcttatatgaaaataccagagattcatcggaaaaggtaacagcctcccaggcg
attctgaacgggctggccggcggcggcggactctatgttccgacggaaataccccgtttg
gatgtgccaatggacgttttgagcaaaatgacgtatcaggaagtggcctatgaggtaatg
cgcagatttctgacggattttaccgaagaagaattaaaaacctgcattgcccgcgcctat
gactccaagtttgacacagaagagatcgcgcctcttgtggaaaaagacggagcctattat
ctggagctgtttcacggagccacaatagcttttaaagatatggcgctgtccattctgccc
catctgatgattactgcagccagaaaaaacaaagtcaccaatgatattgtgattctgacc
gccacatccggagataccggaaaagcggccctggccggatttgctgatgtggaaggcaca
cggatcgttgtattttatccgaaaaacggtgtcagcccgattcaggaaaaacagatggtt
acccagaagggtgagaataccatggtagtgggaatccacggcaattttgacgaggcgcag
accggagtaaagaagatgttttccgatccggcattaaacgctgagatcaatgccagggga
ttccagttctcctctgccaattccatcaacatcggccgtctggttcctcagattgtatat
tatgtctatgcctatgcgcagctgatccgccggggcgcggttcaggagggagagcagatc
aatgtaacggttcccaccggcaatttcggcaacattcttgccgctttctatgcccgctgc
atgggactgcccattgcccgtctgctctgcgcttccaatgagaacaaagtgctgtttgac
tttttctccaccggcacctatgataaaaaccgaccgtttatcctgacctcttccccgtcg
atggatatcctgatttccagcaatctggagcgtctgatttaccggatctgcgggaatgat
tccgaaaagaacaaagcgctgatgcaggcgctggttaccagcggaaagtatgaaatcacc
ccggaaatgcgggagcagctggctgtcttttacgggaattacacgacggaggcggagact
gcggatgtcatccgtgagatttatgaaaagaccggatatgtcattgatacgcatacggct
gttgccgctaaagtgtataaaaagtatctggcagaaaccggggatacgaaaaaaacagtg
atcgcttccacggcaagtccgtttaagttttccagaagcgtcatgaacgccatccatccg
gaatccgtggatctgggagattttgaactggtggacaaactgtccgaactgtccggcgtg
aaagtgccgcgggcaatcgaggagatccgcagcgcgccggtacgccataagacggtatgc
gagatcaatgagatgccggatgtggtaagagattttctgaaatag

DBGET integrated database retrieval system