KEGG   Clostridium sp. SY8519: CXIVA_24940Help
Entry
CXIVA_24940       CDS       T01565                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cls  Clostridium sp. SY8519
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CXIVA_24940
   01230 Biosynthesis of amino acids
    CXIVA_24940
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_24940
   00051 Fructose and mannose metabolism
    CXIVA_24940
   00562 Inositol phosphate metabolism
    CXIVA_24940
Enzymes [BR:cls01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CXIVA_24940
Exosome [BR:cls04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CXIVA_24940
  Exosomal proteins of bladder cancer cells
   CXIVA_24940
  Exosomal proteins of melanoma cells
   CXIVA_24940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710294..2711061)
Genome map
AA seq 255 aa AA seqDB search
MGGESIMSRRKIIAGNWKMNMTPSQTVALIEELKPLTATEEADVVLCVPAIDIIPAVAAA
KGSNIRIGAENMYFEEKGAYTGEISPDMLTDAGAEYVILGHSERRGYFHETDADINKKVL
KAFEHGLTPIICCGESLEQREQGITIDWIRQQIKIAFQNVSAEQAAAAVIAYEPIWAIGT
GKTATSAQAQEVCAAIRVCIGEIYDEATAAAIRIQYGGSVNAKTAAELFAQPDIDGGLVG
GASLKAEFGQIVNYR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagaatccattatgtcacgcagaaagatcatcgcaggcaactggaagatgaat
atgacacccagccagaccgttgccctgattgaagagttaaaaccgttaacagctacagag
gaagcagatgtggtcctgtgtgtgccggccattgatatcattcctgctgttgcggcagcg
aaagggtctaacatccgaatcggcgcggagaatatgtattttgaagaaaaaggcgcgtat
accggagaaatttccccggatatgctgacagatgccggcgcggaatatgtcatcctgggt
cattctgagcggaggggctatttccatgagaccgacgcggatatcaataaaaaagtgtta
aaagcctttgaacacgggctgaccccgatcatctgctgcggtgaaagcctggagcagcgg
gaacagggcatcacgatcgactggattcgccagcagatcaagatcgcgttccagaatgtg
agcgcagagcaggcagctgcggcagtgattgcgtatgagccgatctgggccattggcaca
gggaaaacagctaccagcgcgcaggcacaggaagtatgcgcagcaatccgtgtatgcatc
ggcgaaatttatgacgaagcgacagcagcagcgatccgtattcagtacggcggatccgtg
aacgcgaagacagcggcagagcttttcgcacagccggatattgacggcggcctggtaggc
ggtgcttctctgaaagcagaattcggacagatcgtcaactacagataa

DBGET integrated database retrieval system