KEGG   Clostridium sp. SY8519: CXIVA_25990Help
Entry
CXIVA_25990       CDS       T01565                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cls  Clostridium sp. SY8519
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CXIVA_25990
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CXIVA_25990
Enzymes [BR:cls01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CXIVA_25990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2818020..2818949
Genome map
AA seq 309 aa AA seqDB search
MRHLMTPMDFSTEELEQLLDLANDIEKNPAKYAHACEGKKLATCFYEPSTRTRLSFEAAM
LNLGGSVLGFSSADSSSAAKGESVSDTIRVISCYADICAMRHPKEGAPLVASEHSTIPVI
NAGDGGHQHPTQTLTDLLTIRSLKHRLNDLTIGLCGDLKFGRTVHSLIKALVRYPNIRFV
LISPPELRLPDYIRSEVLDKNNIPYEEMTRLEEALPALDILYMTRVQKERFFNEEDYIRM
KDYYILDKTKMELARKDMIVLHPLPRVNEISTEVDSDPRAMYFRQAQYGVYVRMALILTL
LKMAEPQEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagacatttgatgactccaatggatttttccacggaagagctggaacagctgctggat
ctggccaatgatatcgagaaaaatcctgcgaaatatgcccatgcatgtgaagggaaaaaa
ctggccacctgtttctatgagccaagcacccgtacccggttgagttttgaagctgctatg
ctgaatcttggcggatctgtcctgggattctccagcgctgacagttcatctgccgccaaa
ggcgaaagcgtttcagataccatccgggtcatttcatgctatgcggacatctgcgcaatg
cgccacccgaaagaaggcgcgccgctggttgcttccgagcactccaccattccggtgatc
aatgcgggcgacggcggacatcagcacccgacgcagaccctgacagatctgctgaccatc
cgttcactgaaacaccggctgaatgatctgaccatcggactgtgcggcgatctgaaattc
ggccgtacggtacattccctgatcaaggcgctggtgcgctatccgaatatccgttttgtt
ctgatctcgccgccggagctgcgtctgccggattacatacgttctgaggtgctggacaaa
aacaacatcccttatgaggaaatgacccgcctggaagaagcacttcccgcgctggatatt
ctgtatatgacccgtgtgcagaaagagcgttttttcaatgaagaagactatatccgcatg
aaggactactatatcctggacaaaaccaaaatggaacttgcccgaaaagacatgattgtc
ctgcatccgcttccccgtgtcaacgaaatttccacagaagtggacagcgatccccgcgcc
atgtatttccgtcaggcacaatacggcgtatatgttcgcatggctctgattctgactttg
ctgaaaatggctgaaccgcaggaagagtaa

DBGET integrated database retrieval system