KEGG   Clostridium bornimense: CM240_2289Help
Entry
CM240_2289        CDS       T03165                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
clt  Clostridium bornimense
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:clt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CM240_2289 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CM240_2289 (thlA)
   00640 Propanoate metabolism
    CM240_2289 (thlA)
   00650 Butanoate metabolism
    CM240_2289 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    CM240_2289 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CM240_2289 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CM240_2289 (thlA)
   00310 Lysine degradation
    CM240_2289 (thlA)
   00380 Tryptophan metabolism
    CM240_2289 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CM240_2289 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CM240_2289 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CM240_2289 (thlA)
Enzymes [BR:clt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CM240_2289 (thlA)
Exosome [BR:clt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CM240_2289 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
rep1:complement(2498836..2500017)
Genome map
AA seq 393 aa AA seqDB search
MRDVVICSAVRTAIGSFGGTLKDVPAVDLGAAVIKEALNRANISGEVIDEVIMGNVITAG
LGQNPARQAAVKAGLPIEVSAMTINKVCGSGLRAVSLAYQMIQSGEADAVVAGGMENMSA
APYVVPNARWGARMGDATMKDSMINDALWDAFNQYHMGITAENIAEQWGLTREMQDEFAV
NSQMKAEKAIKEGKFEDEIVPITIPQRKGDPIVFKQDEFPRFGTTIDKLAKLRPSFKKDG
TVTAGNASGINDGAAALVVMSAEKAEALGIKPLAKITSWGSKGVDPKIMGYGPFAATKVA
LERAGLTIGDMDLIEANEAFAAQSLAVAKDLEFNMDIVNVNGGAIALGHPVGASGARILV
TLLHEMKKRDSKRGLATLCIGGGMGTSVIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagggatgtcgttatatgtagtgctgtaagaactgccataggtagttttggtggtact
ttaaaagacgtaccagctgttgatcttggagcagctgtaatcaaagaagctttaaataga
gcaaatatcagtggagaagttatagatgaagttataatgggtaatgttattactgcagga
cttggtcaaaacccagcaagacaagcagcagttaaagcaggacttccaatagaagtgtca
gctatgacaataaataaagtttgtggatctggacttagagcagtatctttagcatatcaa
atgattcaatcaggtgaagctgatgcagtcgttgctggaggtatggaaaacatgtctgca
gctccatatgtagtacctaatgctagatggggtgcaagaatgggcgatgcaactatgaag
gattctatgattaatgatgcattgtgggatgccttcaatcaatatcatatgggtataaca
gcagaaaatattgcagaacaatggggattaacaagagaaatgcaagatgagtttgctgta
aattctcaaatgaaagcagaaaaggcaattaaagaaggtaaatttgaagatgaaatagtg
ccaataactattcctcaaagaaaaggagacccgattgtatttaaacaagacgagttccca
agattcggtactactattgataaattagcaaaattaagaccatcattcaagaaagatgga
acagttactgcaggaaatgcttcaggtatcaatgatggagcagcagcattagttgttatg
agtgcagaaaaagctgaagcattaggaattaaaccattagcaaagatcacttcatgggga
tcaaaaggggtagatcctaagataatgggatatggaccatttgcagcaactaaagttgct
cttgaaagagctggattaactataggtgatatggatcttatagaagctaacgaagctttt
gcagctcaaagtttagcagttgctaaagatttagaatttaatatggatatagtaaatgta
aatggtggagctattgcacttggacatccagtaggagcatcaggagcaagaattttagta
actcttcttcatgaaatgaagaaaagagattcaaagagaggattagcaactctttgtatc
ggtggtggaatgggtacatcagtaatagtagaaagattataa

DBGET integrated database retrieval system