KEGG   Clavispora lusitaniae: CLUG_00004Help
Entry
CLUG_00004        CDS       T01149                                 

Definition
similar to GBE1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
clu  Clavispora lusitaniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLUG_00004
Enzymes [BR:clu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CLUG_00004
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLUG_00004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 583 aa AA seqDB search
MSITDHKSLIKGALDLDPWLEPYSHALISRQLQHKQWLETLQKSEGSLAKFASSYEEYGV
HADPSTKNIVAVAYIPDVVSVSLVGDFNDWNTDSHKYEKVNNFGLWKLVLPPVNGHYAIE
HNSRYKISMVLPSQERIFRLDPWARRVTPSTESTLYEGRFWNPEEAYQFKNTRPSFAKND
GLKIYEAHVGISSPEPKIASYKEFTTNTLPIIHKLGYNTIQLMAVMEHAYYASFGYQVTN
FFAVSSRFGTPEDLKELIDVAHGMGIRVLLDVVHSHSSKNVEDGLNMFNGTDHYLFHGGP
RGAHDLWDSRLFNYSNYETLRFLLSNLKFFIDVYKFDGFRFDGVTSMLYKHHGLSYGFSG
DYNEYFNQDLVDEEAITYLMLAHTLLGELSAKENNFSFTSIAEDVSGMPTLCLPISSGGI
GFDYRLSMAIPDMWIKILKHLSDDEWDLGNIVFNLTNRRYKEKCISYCESHDQALVGDKT
LAFWLMDKEMYTNMSVLSPLTEVVSRGIALHKMIRLITFALGGEGYLNFEGNEFGHPEWL
DFPREGNGESYHYARRQFNLIKDDLLRYKFLFSVRCCHDPLGY
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataaccgatcacaaatctctcatcaaaggagccttggacttggatccttggtta
gagccttattcccacgcacttatcagtcgtcaattgcagcacaagcaatggttggagact
ttgcaaaagtcggaaggtagccttgccaagtttgcttcttcttacgaagagtacggtgtt
cacgctgaccccagcacgaagaatatcgttgctgtagcatatattccggatgtggtgctg
gtttcgcttgtgggtgactttaacgattggaacactgattcacacaagtatgaaaaggtg
aacaactttgggttgtggaaattggttcttcctcctgtcaatgggcactatgctatagag
cacaactcccgctacaaaatctcgatggtccttccttcccaggagcggattttccgtctt
gatccttgggctcggagagtgaccccttccaccgagagcactttatatgaaggccgcttc
tggaaccccgaggaggcttatcagttcaaaaacacgagaccctcttttgctaaaaatgac
ggtttaaagatctatgaggcacacgtgggaatctcgtccccagaaccgaagattgcctct
tacaaggagttcacgacaaatactcttcctatcattcacaaattgggttacaatacaatc
cagttgatggcagttatggaacatgcatactacgcttctttcgggtatcaggtcaccaat
ttcttcgctgtctcgtcccgttttggaactcctgaagatttgaaggagttgattgatgta
gcccatggcatgggaatccgtgtgttgcttgatgtggtccactctcacagttcaaagaat
gtggaggatggtttaaacatgttcaatggtactgaccactatttgtttcacggtggacca
aggggagcacacgatttgtgggactcgcgcttgttcaattactctaactatgaaacgttg
cgcttcttgttgtctaacttgaaattctttatcgatgtctataagtttgatgggtttagg
tttgatggtgtcactagcatgttgtacaagcaccatggtttaagttacggcttcagtggt
gactacaatgagtacttcaatcaagatttggttgatgaagaggctatcacctacctcatg
ttagcacacactttgcttggcgaattaagtgctaaagagaacaacttctccttcacttct
attgctgaagatgtgagtggaatgccaacattgtgcttgcccatctcctccggaggcatt
ggttttgactacagattgtcgatggcaattcccgatatgtggattaagatcttgaaacat
ttgctggacgatgagtgggatttgggtaatattgtgtttaacttgacaaacaggaggtac
aaggaaaagtgtatcagttattgcgagtctcacgaccaagccctcgtgggtgataagact
cttgcattctggctcatggataaggaaatgtacacgaacatgtctgttctttctccattg
acggaagttgtctccagaggtatcgcactccacaaaatgatcagattgatcacttttgcc
ttgggtggagaaggatatctcaattttgaaggtaacgagtttggtcaccctgagtggttg
gacttccccagagaaggaaatggggaatcgtaccactacgctaggcgtcaattcaatttg
atcaaagatgatttgttacgttacaaatttcttttttcagttcgatgctgccatgatcca
cttggatactaa

DBGET integrated database retrieval system