KEGG   Clavispora lusitaniae: CLUG_00077Help
Entry
CLUG_00077        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CLUG_00077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 645 aa AA seqDB search
MSLLTNRKRPRGFSESFDSSRKPATNEGIHNASNQSVKAFENLSSSSSSTFNESPNLNLN
MNLSTSHDNCGPYDKNSYLAGDDNGNAILEEQEDDYYDENGDIFDNDVIFVEERRLKNPQ
RMRTYRNNSDSAVFLERDVLEAYNMFNVNNSPPTSSFEIHHNMGAKKQRTSSLPQLPQVK
CFYQKLPNNYVHQQPKVGNIKTHVIPHKLNMPPCDDEDGHYIIRINDVFANRFVIQKLLG
QGTFGKVVACYDKLNRETVAIKIIRNIPKYRDAAKIELRVLTTLKQFDNENRNHCIHLRE
CFDFRGHICIVTDLLKISLYDFMENNKFIPYPGSHIQAISKQLIRSVTYFHELNLIHTDL
KPENILLHDDSYQRKPLQSNTIITSYLNLSSVEPRKKQKVPKYVRVLNNPLIQIIDFGSA
IFDDEYHSSIVSTRHYRAPEIVLGVGWSFPCDMWSIGCILVELVIGEPIFRTHDNLEHLA
MIEKIVGSKIDKEMVRFSKQMDNECGLKYFTNDYRRPNSEGSDFEDDDLDDDVIIDDEST
EDNSLTLMFPTPSTPEKFIRSVDQLSRIDLFISERIGLVIDFDYSLSENFQNNQHLINFG
NFTFWWFFIDLLRKLFVINPRERITALEALEHPWFNLGIEDEGTL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcctcaccaatagaaaaagaccccgtggattcagtgagtcttttgatctgtcc
cgcaaacctgcaacaaacgaaggcattcataatgcttctaatcagctggtaaaagctttc
gaaaacctttcatccctgtcaagctcaaccttcaacgagtccccaaacttgaatctcaac
atgaatctttcaactagtcatgacaactgtggtccctatgataagaatctgtatcttgct
ggcgatgataatggaaacgctatcttagaggaacaagaagatgattattatgacgaaaat
ggagatatatttgataatgatgtcattttcgtggaagaaagaagactaaaaaatcctcaa
cgcatgaggacttaccgaaataattctgatctggcagtctttttagaaagagacgtcttg
gaagcttacaatatgtttaatgtgaacaatctgcctccaaccctgtcatttgaaatccat
cataacatgggtgctaaaaagcagagaactagctcgctaccccaattgccacaagtcaaa
tgcttttatcaaaaactcccaaacaattatgtgcatcagcaacccaaagttggaaacata
aaaactcatgttatccctcataagttgaatatgccgccttgcgatgatgaagatgggcac
tacatcataagaattaatgatgtttttgccaatcgctttgtcattcagaagttgttgggt
caagggacattcggcaaagttgtcgcttgttatgacaaacttaatcgtgaaacagttgca
atcaagatcatcagaaacatacccaagtacagagatgcagctaagatagagcttagagtt
ttgacaactttaaagcaattcgataatgaaaatagaaatcactgcatacatttgagggaa
tgttttgactttaggggccatatatgtattgtcacggacttgttgaagatttctttgtac
gattttatggaaaacaacaagttcatcccctaccctggatctcatattcaagcaatctca
aagcagttgatccggtcagtgacgtatttccatgagctaaacctcatacatacggatctc
aagccggaaaacattttgttgcatgatgattcctaccaaaggaaaccccttcagagcaac
accataatcacaagctacctcaatttgagtagtgtggagccgagaaagaagcaaaaggtg
ccaaagtacgtcagagtcttgaataaccctttaattcagatcattgacttcggttcagca
atatttgacgatgaataccactcatctatagtatcaacgagacactatagagctcccgaa
atcgtgttaggggtaggctggtcttttccttgcgatatgtggtccatcgggtgtattttg
gtggagcttgtgataggtgagccgatctttagaactcacgataatttagagcatctagcc
atgattgagaaaattgttggctcgaaaattgacaaggagatggttcgtttctcaaagcag
atggataatgagtgtggtttaaaatatttcaccaacgattacagaagaccaaactcagaa
ggaagtgattttgaagatgatgatttggatgacgatgttatcattgatgatgagtcgaca
gaagataactcgcttacgctcatgtttccaaccccttccacccctgaaaagtttatccga
agtgtggaccagctttcgcgcattgatctatttattagtgagcgcatagggctagttatt
gactttgactactcgctcagcgagaacttccaaaataaccaacacttaatcaactttgga
aattttactttttggtggtttttcattgatttactacgcaagctttttgtgataaaccca
agggagcgaatcacagcgctagaggcgcttgagcatccatggttcaacttaggtattgag
gacgaaggtacgttatga

DBGET integrated database retrieval system