KEGG   Clavispora lusitaniae: CLUG_00102Help
Entry
CLUG_00102        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
clu  Clavispora lusitaniae
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLUG_00102
   00330 Arginine and proline metabolism
    CLUG_00102
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CLUG_00102
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CLUG_00102
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CLUG_00102
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     CLUG_00102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 173 aa AA seqDB search
MSIPVVVIGAGVVGLTTALQLKRENSAYDITIVGTFLPGDISLFYTSPFAGANWHSFASV
EDKYLQELDTVGYHELMRLADDPQSGIWRKPNASYYTPQALEEVNGDVSKFNDWFDAMTN
TRILPKDELRPGTVFGKESEGLVLSVPRLLDLFAPKVSCIRNCREKSSTDHPH
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattccagtagtagtgattggtgctggagttgttggacttacaactgcgcttcag
ttgaaaagagaaaactcagcctatgatatcactatagtcggcacatttttgcctggtgat
atatcgcttttctacacctcaccatttgctggcgcaaattggcactcttttgcttctgtc
gaagacaaatacttacaagaattggatacagttggttaccatgagcttatgcggttggca
gacgatccgcagtctggaatttggagaaagcctaatgctctgtactatactccacaagct
ttggaagaggtcaatggcgatgtttccaagttcaatgactggtttgatgctatgaccaat
acccgcattttacctaaagatgaacttcgtccaggaacagtctttggtaaagaatcagaa
ggtctagtattgtcagttccccgtctacttgacttatttgctccaaaagtgtcttgcatc
aggaattgtcgtgaaaagagttccacagatcacccacattga

DBGET integrated database retrieval system