KEGG   Clavispora lusitaniae: CLUG_00176Help
Entry
CLUG_00176        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
clu  Clavispora lusitaniae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:clu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:clu01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MSSDNLEAVDLTSLNALAAGFNKKAPRIVAAGLGGKLMGTKSLVDVTADQMTKDSETLLE
KDEREREKYMRTAHISEQPWTLSNWHQHVNWLNVILVILIPAFGCYSAYHYPPQLKTVLL
GALMYLFSGVSITAGYHRLWSHKAYDAAVPVRLFFAFFGAGAVQGSIKWWGHSHRIHHRF
TDTNRDPYDARQGFWFSHMGWMLSIANPKNRARADISDLTADPIVVFQHRHYLLLMVTAA
VLFPCLIAGLFWGDYWGGFIYAGILKFFFIQQATFCVNSLAHWIGVQPFDDRRTPRDHVL
TALVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKVTIWLLSKVGLAWNLKTFSQNAIEQG
LFQQQQKKLNRMKNKLNWGPAVSELPVWDKDHFNEIAKEEGLIIISGIVHNVKSFIKEHP
GGQALVRASLGKDATKAFNGLVYAHSNAAHNMLATMRVAVIKDGEVNGDTFGLQEEMMAK
KDL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgataacttggaagcggtcgatttgacctcgctcaatgctcttgctgctgga
ttcaacaagaaagcgcccagaattgtcgctgcgggcttgggcggaaaattgatgggcaca
aagtctttggtggatgtcaccgcagaccagatgaccaaggacctggaaactcttctcgaa
aaggacgaaagagaacgtgagaagtacatgcgtaccgcccacatttccgaacagccttgg
accttgagcaactggcaccagcacgtgaactggttgaacgtcattcttgtcattctcatc
cctgcctttggctgctactcggcctaccactacccacctcagttgaagacggtgctcttg
ggtgccctcatgtacctcttctctggtgtttccatcactgcaggctaccacagactatgg
tcgcacaaggcttatgatgctgctgtgcccgtgagacttttctttgcctttttcggcgcc
ggtgctgtgcaaggttccatcaagtggtggggccactcgcacagaatccaccacagattc
actgacaccaacagagacccttacgatgccagacaaggtttttggttttcgcacatgggc
tggatgttgagcattgccaaccctaagaacagagccagagcagacatctctgacttgact
gctgaccccattgttgtgttccaacatcgccactacttgcttctcatggtgactgccgct
gtgcttttcccctgcttgattgctggtcttttctggggcgactactggggaggtttcatc
tacgcaggtatcttgaagttcttcttcattcaacaagccactttctgcgtcaactctttg
gcccactggattggtgtgcaaccttttgacgacagaagaaccccaagagaccatgtcctc
actgcattggttacctttggtgaaggctaccacaacttccatcacgagttcccctctgac
tacagaaatgccttgaagtggtaccaatacgacccaaccaaggttaccatttggttattg
tcgaaggttggcttggcctggaacttgaagaccttctcccaaaacgccattgagcagggc
ttgttccaacaacaacagaagaagttgaacagaatgaagaacaagttgaactggggccct
gccgtcagtgaattgcctgtttgggacaaggaccacttcaacgagattgccaaggaagag
ggccttatcatcatttcgggcattgttcacaatgtcaagagcttcattaaggaacatcct
ggtggacaggcattggtgagagcttctttgggcaaggatgctacaaaggctttcaacggt
ttggtttacgcacactctaacgctgctcacaatatgttggctacgatgagagttgctgtg
atcaaggatggagaagtcaatggcgatacctttggcttgcaagaagaaatgatggccaag
aaggatctttag

DBGET integrated database retrieval system