KEGG   Clavispora lusitaniae ATCC 42720: CLUG_00192Help
Entry
CLUG_00192        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K11873  ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
clu  Clavispora lusitaniae ATCC 42720
Brite
Enzymes [BR:clu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CLUG_00192
Peptidases [BR:clu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CLUG_00192
Ubiquitin system [BR:clu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CLUG_00192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 8500352
NCBI-ProteinID: XP_002619033
UniProt: C4XW69
AA seq 650 aa AA seqDB search
MSNPLVDRILSNPLTFVAAKQPEKETHEQPPSYIVLGKKSKPLPNMLKPKTAKPEVKRPK
SMAEAIAAYTGKKYASKEKKPKPRPESSDDEKYESASEFQTDSSFQGFKSSEGSDTKSDK
SDKSDESDSEDGEYESAGVSIDSETDGEESGSDSEPESDSQLEGSALEEESGEQSDEEKS
EVETETKSEPMTPSTETQSKESSFDEPSQESDRETETPNETLRTLKRELKEELQEDPKGK
LPENENGSLHQNEKELIDKEQDDDPHHSGKLTQTKQEDSQELYEFLRPNEPRPQSGRIAT
HWSPSCVSSRPSGLVNFGVTCYMNSAIQAMMHIPAVQQYLAEVQQGKHKLPPRSVTHTFA
ELANKMWRSGSRKYVNPKRLVQRLGDINCMMSEWQQEDSHEYLMSLMARLQEDSTPKGRK
LAESVVYDIFGGVLDQEVVCQQCGGVSTTKQEFYDLSLGLRKRRAEGGRYSIEKSIADFF
SRETIKRDAADAASGYHCERCQQRTVATKKSTVAEAPQTLVVHVKRFKFNGNSSAKVKQP
VAYTKYLDLTPYMTSGSECRYQLLAVIVHEGRSMSSGHYVAHCLQPDGTWATYDDEYINQ
IAERDALNDPAAYCLVYTRLERRKEGEGSERVKRTQKQGGNQEAKRARVA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacccgttggtggaccgcatcctcagtaaccccttgacatttgtcgcggcgaaa
cagcccgaaaaggaaacgcacgagcagccacccagttatattgtgctcggcaaaaaaagc
aagccgctccccaatatgctcaaaccaaaaacggcaaaacccgaagtaaaacggccaaag
tccatggcagaggctatcgcggcgtacaccggaaagaagtatgcgagtaaagagaaaaag
cccaagccgcggcctgagtcgtcggacgacgagaagtatgagtctgcttcggagtttcag
acagacctgtctttccaagggtttaaaagctcagaaggcagcgacaccaagagcgacaaa
agtgacaaaagtgacgaaagcgatagtgaagacggcgagtatgaactggcaggtgtttct
atagatagtgagactgatggagaggaatcaggatctgattctgagcctgaatcagactcg
cagttagaggggtcggcattagaagaggaatcaggtgaacaatctgacgaagagaagtca
gaagtagaaacagaaacgaaatctgagcctatgacaccatccacagaaacacaatccaaa
gagagtctgttcgatgagccatcacaagaatcagatagagaaacagaaacaccaaatgag
accctacgcacactcaagcgcgagctcaaagaggagcttcaggaagaccccaagggcaag
ttaccagagaacgaaaacggaagcttacatcagaatgagaaagaactcatcgacaaggaa
caggacgatgatcctcaccattctgggaaacttactcaaaccaaacaggaagattctcaa
gaactatacgagtttctccgcccgaatgagccacgcccgcaaagtggacgcattgctact
cactggtcaccttcgtgtgtttcttcacgtccgctgggtctagtgaactttggcgtcacg
tgctacatgaacctggctatccaagccatgatgcacattccagccgtgcagcaatatttg
gctgaagtacaacagggcaagcataagctcccacctcgactggttacgcacacattcgct
gagcttgcgaacaagatgtggcggtctggcctgcgcaagtacgtcaacccaaaacgcttg
gtccagcggttaggtgacatcaactgcatgatgagcgagtggcagcaggaagatctgcac
gagtacttgatgagcttgatggctcgccttcaagaggatctgactcccaagggccgcaaa
ttggccgagtcggtcgtgtacgacattttcggaggtgtgcttgaccaagaggtggtgtgc
cagcagtgtggtggggtaagtactaccaagcaagaattctatgatctttctcttgggctt
cgcaaacgccgcgcagaaggtggccggtactccatcgagaaaagcattgccgatttcttc
tcccgcgaaaccattaaacgtgatgcagccgatgccgccagtggctaccattgcgaacgg
tgccaacaacgaaccgtggcgacaaaaaagagcaccgtggctgaggcaccgcaaacacta
gtggtacacgtgaaacggttcaagttcaatggaaactcgctggccaaggtcaaacagcct
gtggcatacacaaagtatcttgacttgacgccgtacatgactctgggatccgaatgtcgt
tatcaacttttggctgttattgtgcacgagggccggtccatgctgtctggccactacgtg
gcgcattgtcttcaaccagatggcacgtgggcaacatatgacgacgagtacattaatcag
attgctgagcgcgacgctttgaacgaccctgccgcatactgccttgtgtatacgcggttg
gagagacgcaaagagggagagggatcggaacgtgtgaagagaacccagaaacagggtggt
aatcaagaggccaagagggcccgtgtagcatag

DBGET integrated database retrieval system