KEGG   Clavispora lusitaniae: CLUG_00281Help
Entry
CLUG_00281        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CLUG_00281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 842 aa AA seqDB search
MPPTLNTRRRNLLNQIKITNNRIYDSIPEGKRRRAASTREPERVFRSSRSSGKPIEVKAL
PRRKTQSAPTVVPQNGTTLRRIGRPRLFSVTVLEKNPDRYILKIKYNRRNRMARRLLGTK
NQPKPEPEKASYAPSIQTSKRKRGRPPITKPPPVLEDIAPEEPDLDVLETSIDSELPYKG
VLPFPDCTINSTDPTPLDREMFAQFQLEGERRKREQEDAILQLRDDDTEQKESNNSTPMP
QSYYYQKSRIEKIQFREFVIDTWYSSPYPEEYSQSQILYICEHCLKYMKSPMSYDRHQLK
ICTIANNHPPGVEIYRDSEAKIAIWEVDGRKNIEYCQNLCLLAKLFLNSKTLYYDVEPFL
FYILTEIDDHDPSIYHFVGYFSKEKLNNSDYNVSCIVTLPIYQRKGYGSLLIDFSYMLSR
SEFKFGTPEKPLSDLGLLSYRAYWKVTIAYVLRDLHNKYLSQSNDNNIMLSIEILSKLTG
MKPSDVVVGLEQLNALVKSVETGGYAIVINLPVIDKVIAKQEKKGYIKLKQQNLQWKPLI
YGPSGGINSAPAYLASAGNTGAASQASQPIPISNSISMISEFLKDDINNPYTYEEEAYKE
IDSLTSGEVKDNLRRWRTKDGEWDTNSLVVCHPDFANGIPMVRSYTNASNDPKIMDEFQE
QVSEGESELGIDEIIDDEQPSYDESADLEEEASDEAIFEDTQNGGDEDNADEDDADEDES
DEDDAGEDDADEDDADEDDADDADEDDADEELSNSNQTGGGKGDFNNEKEKGLQTYDTYL
EIGPTKGQETSDSEEEVVQRRFRRKKQQPSLTRKSRRLRSSNVVSNGDVLGRRLRTRRNL
GN
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccacactaaatacaaggcggcgaaatcttctaaatcagatcaaaatcacgaat
aatagaatttacgacagcatacccgagggaaaacgccgacgggcagcctcgacacgcgaa
cctgagcgagtatttcggtcttctcggagttctggaaaacccatcgaggtcaaggctcta
ccgcgccgaaaaacacaatctgctcctaccgttgtaccccagaatggtactactttgcgg
cgaatcgggaggccgcgcttgttttctgtgacggtgcttgaaaagaacccagatcgctat
attctcaaaatcaagtacaacagacggaatcgcatggcccgtcgactcttggggactaaa
aaccaaccgaaaccagaacccgaaaaagcatcgtatgctccgagcatccaaactagcaag
aggaaacgtggccgccctcctattactaagccccctccagtgttggaggacattgcacct
gaagaaccagacttggatgtgcttgaaacaagcatagatctggagcttccatataaaggt
gttcttccatttcctgactgcacgatcaatctgacagatcccaccccgttggatagagaa
atgtttgcccagttccaactagaaggtgaaagaagaaaacgcgaacaagaagatgctatt
ctccaactacgagatgatgacacagaacagaaagagtcgaacaattcgacgcctatgcct
caactgtattactaccagaagtcacggatcgaaaaaattcagtttcgcgagttcgtaata
gatacgtggtactcgtcaccataccccgaagaatattcacaaagccagatcttgtatatt
tgtgaacattgcttgaagtacatgaaatcgcccatgtcctatgacagacaccagctaaaa
atttgcacaatcgcaaacaatcatcccccaggagtggaaatttatcgcgactcagaggcg
aaaatcgccatatgggaggtcgatggtcggaagaacattgagtattgccagaacctttgc
cttttggctaagctctttttgaattcgaaaacgctatactacgatgttgaaccttttctc
ttctatattcttacagagatcgacgatcatgacccgctgatatatcattttgtgggatat
ttctccaaagaaaaattgaataattcggattataatgtcagttgcatcgttactcttcca
atctaccaacggaaaggttatggcagcctattgatagattttagctacatgctttcccgc
agcgagttcaaatttggaactccagaaaagcctctcagtgacttgggacttctcagttat
agggcatactggaaagttacaatagcatatgttctaagagatcttcataacaagtatttg
tcacagagcaatgacaataatatcatgctatcgattgagattttgtccaaacttacagga
atgaaaccgtctgatgttgtcgttgggcttgaacaattgaatgctctcgtaaaaagtgtc
gaaactggaggatacgcgattgtcatcaatttgccagtgattgacaaagtcattgcaaaa
caagaaaagaaaggctatatcaagctcaagcaacaaaatcttcaatggaagccattaatt
tatggcccatctggaggaattaactccgcaccagcatatttagctctggcggggaatacc
ggcgctgcctcgcaagcgtcgcaacctataccaataagcaatagcatttccatgatttca
gaatttttgaaagacgatatcaataatccttacacatacgaagaagaagcatacaaagaa
atcgatctgctcacatctggggaagtcaaagacaatctcagaagatggcgaactaaagat
ggagagtgggatacgaatagcttggttgtgtgccatcctgattttgcaaatgggataccg
atggtaaggagttacactaatgcaagtaatgatccgaaaatcatggacgagtttcaggag
caagtttcagagggggaatcagagttgggaattgatgaaattattgatgatgaacaacca
tcgtatgatgaatctgcggatcttgaagaggaggcatcagatgaagctatttttgaggat
acccaaaatggtggagatgaagataacgcggacgaggatgatgcagatgaggatgaatct
gatgaagatgacgcaggtgaagatgacgctgatgaagatgacgctgatgaagatgacgct
gatgacgcagatgaagatgatgcagatgaagaacttagtaacagtaatcaaacaggtgga
ggaaaaggtgatttcaataatgaaaaagagaaaggtttacagacatacgacacatatttg
gaaattgggccgactaaaggacaagaaacttcagatctggaagaagaggtcgttcaacga
cgctttcgaagaaaaaaacaacagcctagtctaactagaaaatctaggcggcttcgaagc
agcaacgtcgtctccaatggcgatgttttaggaaggcgtctccgaaccaggaggaacttg
ggtaattaa

DBGET integrated database retrieval system