KEGG   Clavispora lusitaniae: CLUG_00334Help
Entry
CLUG_00334        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CLUG_00334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MSEYGVLAERNIERVSFGDYDFNTWYGNGAYFSPGSSDLGVDCCISGRRKSAPVRAPHFW
LDCLYVCDFCFKYSTDRALMAQHRAICPLNKAYPPLGTLVYADSKSRRVIKRIRGFRHEL
FCQNLALFGKLFLDDKSVYYNVDAFDFYVVYAPETNHDAGERARLKPMGFFSKEVNAWDE
DNNLACICVFPPFQRLRLGSLLVEFSYALARVTPGQARSGPEFPLSPFGQATYLRFWAKR
LAFVIWNDFSTAESVSLRDLADKTGFRKDDCLLALEYMGVLFEAEEVILERRALRGWCDA
NNVDPTVLATSLDPAGILF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagtacggagttctcgcggagcgcaacatcgagcgagtttcgtttggcgactac
gacttcaatacctggtacggcaacggcgcgtatttttctcccggctcgagcgacttgggc
gtcgactgctgcatatccggtcgacggaaaagcgcgccagttcgcgcgccccatttttgg
ctcgactgtctctatgtgtgcgacttttgcttcaaatacagtacagaccgcgccctaatg
gctcagcaccgcgccatctgcccgctcaataaggcatacccgccgcttggaacgttggta
tacgctgactcaaaatcacggcgcgtcatcaaaaggatccgcggtttccgccacgaactc
ttctgccagaacttggcgcttttcggcaagctttttctagacgacaagtccgtctattac
aatgtagacgcctttgacttctatgtggtgtatgcgcctgagacaaatcacgatgcgggc
gagcgcgcacgcctaaagcccatgggctttttctccaaagaggtgaatgcctgggacgaa
gacaataaccttgcatgtatctgtgttttcccgccgttccagaggcttcgcttggggtct
ttactagtggagtttctgtatgctttggcgcgagtcacccccggccaagctcgcctgggg
ccagaattcccgctctcgccttttggccaggcaacatatcttcgattctgggctaaacgc
cttgcgtttgtgatctggaatgatttttctactgcagaaagtgtgtcgctacgagatttg
gccgacaaaacaggctttcgaaaagacgactgtttactagcattggaatacatgggtgtt
ctattcgaggccgaagaggtgattttggagcgtcgtgctctcagaggttggtgcgacgcc
aataatgtggatcccactgtacttgcaacctcgcttgacccggctggtattcttttctga

DBGET integrated database retrieval system