KEGG   Clavispora lusitaniae: CLUG_00374Help
Entry
CLUG_00374        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
clu  Clavispora lusitaniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:clu00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 540 aa AA seqDB search
MIFFYSYPMQLSLFLAWAVAASAFYIPFRLPQIPFLVSLDTKTQDEYMTDPQFELWVAQQ
SNYSFQYILENIGGVSSILDKSEVAPGVVIASPSKEHPNYFYNWIRDSALTLRSVIYYLD
DGAEHLRHAEELRAVVEQYMEINYELQRLSNPSGDFDDNTRSGLGEPKFMPDASVFKENW
GRPQSDGPGLRVSTISNYIAYLKKYKLDFSNNFLGNTSNVYYGIVRPDLEYIMANWKKDS
FDLWEEINSVHLFNALTQLRALKDGHKLAKHVGDSSEFLNLLETSFNELKNYILDSNTGF
TQFSLPYLVETPSLVQQRKRAGLDAATLLASLHAHNLEYGNTDVIPFDVEDGHVLSTISA
MVADMKYRYPINHDKIRLPQSIGVALGRYPEDIYDGYGTSEGNPWFISTATAAEVLYKWI
FKALKSNEDIVLTSEHEHFFAPFFPDDKFTTSKTIVYGSEEFGTLLVQMFNYSDSFLQVI
QAHVDSVSGKMSEQFNKYHGFMQGAESLTWSYSAFYNSVRWRLKTSTELDKYFEQANRTH
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgatattcttttattcatacccgatgcaacttctgttgtttttggcctgggcggtagcc
gccagtgccttttatattcccttccgccttccccagattccctttcttgtgtcattagat
accaagacccaagatgagtatatgactgatccgcagtttgagttatgggtggcccagcag
tcgaattactcattccagtatatattagagaacattggaggtgtcctgtctattctcgat
aagtcggaagtggctccaggtgttgtgatagcctctcctctgaaagaacatccaaattat
ttctacaattggattcgtgactcggcgttgacgctccggtcggtgatttattatttggat
gacggagctgaacatttacgtcatgctgaggagttgcgtgctgtggtggaacagtacatg
gagataaattatgagcttcaacggctctcaaatccttccggtgattttgacgacaatact
cgatctggacttggagaacctaagttcatgccggatgcgtctgtcttcaaagagaattgg
ggccgtccccagtcggatggccccggtttgcgtgttctgactatatccaattacattgcg
tacctcaaaaagtacaaattagacttttccaacaactttttgggcaacacatctaacgta
tactatgggattgttcggccggatttagaatacattatggccaactggaagaaagactct
ttcgacttgtgggaagagattaattctgtgcatcttttcaatgccttgactcaattgcgg
gcacttaaggatggtcacaagcttgccaagcatgtgggggactctctggaatttttaaat
ttattagaaacatctttcaatgagcttaagaactatattctagactcaaatacgggcttc
acgcaattttcgttgccgtatctcgtggaaacaccgtctcttgttcagcaacggaaaaga
gctgggcttgatgctgcaacattgttggcatccctccatgcacataacttagagtacggc
aacacggatgttattccgtttgacgtcgaagatggccatgtcctcagtactataagtgca
atggttgccgatatgaagtacaggtatccaatcaatcatgacaagattcggttgccacaa
agcattggcgtggcacttggaagatatcctgaggacatttatgacggctatggcacttct
gaaggaaacccttggttcatctccactgcaactgcggcggaagttttgtacaaatggatt
ttcaaggcgttgaagctgaatgaagatatcgtgttgacctctgaacatgaacattttttc
gcccccttttttccagacgataagtttaccacttcaaagaccatagtttacggcagcgag
gaatttggcactttgcttgtgcaaatgttcaactactcagactcattcttgcaagtgatc
caggctcacgtagatagcgtttcggggaaaatgctggagcagttcaacaaataccatggc
tttatgcaaggagcagagagtttgacgtggtcttactcggctttttacaattccgtcaga
tggaggctcaagacatcgacagaactcgacaaatacttcgagcaggcgaaccgtacacat
tag

DBGET integrated database retrieval system