KEGG   Clavispora lusitaniae ATCC 42720: CLUG_00556Help
Entry
CLUG_00556        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01656  anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01230  Biosynthesis of amino acids
Module
clu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLUG_00556
Enzymes [BR:clu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CLUG_00556
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CLUG_00556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS GATase Peptidase_C26 Peripla_BP_2
Motif
Other DBs
NCBI-GeneID: 8499695
NCBI-ProteinID: XP_002619397
UniProt: C4XX83
AA seq 523 aa AA seqDB search
MTQKMGVLKSQSVIKFAPYNFSMSQTPKHVLMIDNYDSFTWNLYQYLCQSELCAKVDVYR
NDEIDIETIENVIKPDLLFISPGPGHPSTDSGLSKRAIEYFKGKIPIFGVCMGQQCMVEV
FGGEVTFAGEIVHGKTSTVKHDGKGAFAGIPQGVAATRYHSLAGTKGKIPDCLEVTATTE
SDPEVVMGVRHKKYTIEGVQFHPESILTEAGHELIENVLRMNGGTWEESQASKPKGNILE
TIYKQRIEDYAAIEAQPGKSFADLQVSLDLGVAPPLVNFYQRLASTKTRGETIILSEFKR
ASPSKGDINISAHPGKQALTYARNGCSAISVLTEPKWFKGSVDDMSLIRQVIANEKDRPA
VLRKEFIFSKYQILEARLAGADSVLLIVKMLKDAQLLQTLYEYSLSLGMVPLVEVNDSDE
LKVALALTNNNSKADSLVIGVNNRNLTTFDVDLNTTSSLVSEAKNSGREGDVLVLALSGI
TTSQDVKKYKYEDNVDGFLIGESLMRAEEKGEAGTFLHELIHI
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactcagaaaatgggtgtactcaaatctcaatctgtaataaaatttgccccatacaac
ttcagcatgtcccagaccccgaaacatgtgttgatgatcgacaattacgactcgtttact
tggaatttgtaccagtacttgtgtcagtccgagctctgcgccaaagtcgatgtttataga
aacgatgagattgacattgaaacaattgaaaacgttataaagcccgatcttttgttcatt
tcgccgggcccaggccacccatcgacagactcgggcctttccaaaagagccattgagtat
ttcaaggggaaaatccccattttcggcgtttgcatgggccaacaatgtatggttgaggtt
ttcggaggagaggtgacttttgccggcgaaattgtccacggcaaaacgtccactgtgaag
cacgatggaaagggtgcatttgcagggatcccacaaggtgtggccgctacaagataccac
tctttggccggaaccaagggcaaaattcccgactgcttggaagttacggcaaccacagag
ctggatccggaggttgtcatgggagtcagacacaaaaagtacacaatcgagggtgtgcag
tttcacccggagtctatcttgaccgaggcggggcacgagcttattgaaaatgtcttgaga
atgaacggaggtacttgggaagaaagccaggctagcaagcccaagggaaacatactagag
accatttacaagcagcggattgaagactatgctgccatcgaagcgcagcctggaaagtcc
tttgcggatttgcaagtgtcgttggatcttggcgtggctcctccacttgtgaacttctac
caaagacttgcgctgacgaaaactcgcggcgaaaccatcatcttatctgagttcaagaga
gcatcgccatctaaaggagacatcaacatctctgcgcatccaggaaaacaagcattgact
tatgcccgcaacggatgttctgccatttccgtcttgaccgaacccaagtggttcaaagga
tccgtcgacgacatgtctttgattcgccaagtgattgccaacgaaaaggaccggcctgct
gttttaaggaaagagtttattttcagcaagtaccagatcttagaggcacgtttggccggc
gcagactctgtgttgttgattgtgaagatgttgaaagacgcccagttgttgcagaccttg
tatgaatactccttgtcgttgggcatggttccccttgtcgaagtcaacgactcggatgag
ttgaaagtcgctttggctttgacaaacaacaactccaaggcagattcacttgtcattgga
gtcaacaacagaaacttgacgacgtttgatgtggacttgaacaccacaagctctttggtt
tccgaggcgaaaaacagcggcagagaaggggacgttttggtgttggctctttcgggaatc
accacttctcaggatgtgaaaaagtacaagtacgaggacaatgtggatgggtttttgatt
ggagagagtttgatgagagcagaggaaaaaggcgaggctggaacgtttttgcatgagctc
atacacatttaa

DBGET integrated database retrieval system