KEGG   Clavispora lusitaniae: CLUG_00572Help
Entry
CLUG_00572        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
clu  Clavispora lusitaniae
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:clu04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 342 aa AA seqDB search
MEQASQPPGAQKKKLSRDTTTKGKYSLNDFQILRTLGTGSFGRVHLARSVHNGRFYAMKT
LKKERVVQMKQVEHTNDERRMLKLAQHPFIIRMWGTFQDCNNLFMIMDYIEGGELFSLLR
KSQRFPTPVAKFYAAEVFLAIEYLHSFDIIYRDLKPENILLDKNGHIKLTDFGFAKEVED
VTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENILNG
TITYPDYLQPDILDLLQKLIVKDLTQRLGNLQNGSDDVKNHPWFKEVVWERLLSRDIETP
YEPPITSGVGDTSQFDRYPEDKDLDYGITGVPDPYADKFVDF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagccagccagccgccgggggcacagaaaaaaaaactttccagagacacaacc
accaaaggcaaatactcgttaaatgactttcagattctcagaacgttgggcacagggtcg
tttgggcgggtgcacttggcccgttcggtccacaacgggcggttctacgccatgaagacg
ttgaagaaggagcgggttgtccagatgaaacaggtggaacacacaaacgacgaacggcga
atgttgaagttggcgcagcatccgttcatcatccgcatgtggggcacgttccaggactgc
aacaacttgttcatgatcatggactacatcgagggaggcgagttgttcctgttgttgaga
aagtcccagcggttcccaacgcccgtggccaagttctacgcggccgaggtgtttttggcc
atcgagtacttgcatagcttcgacatcatctaccgggatttgaagcccgaaaacattttg
ttggacaagaacggccacatcaagttgacggactttggttttgccaaagaggtggaggac
gtgacatacaccctttgcggcacgcccgattacattgcgcccgaggttgtagccacgaaa
ccatacaacaagtccgtggactggtggtcgtttgggattttgatctttgagatgctcaca
ggttacacgccgttttacgacccgacgccgatgaaaacgtatgaaaacatcttgaacggc
accatcacgtaccccgactacttgcagccggacattttggacttgctccagaagctcatt
gtcaaggatttgacgcaacgacttggcaatttgcaaaacggctctgacgacgtgaaaaac
catccgtggttcaaggaagtggtgtgggaaaggctcctttcgcgcgacattgaaacgccg
tacgagcctcccatcacctccggagtcggtgacacttctcagtttgaccgctatccggaa
gataaagacttggactatggaatcaccggagtgccagatccatacgcagacaaatttgtg
gatttctag

DBGET integrated database retrieval system