KEGG   Clavispora lusitaniae: CLUG_00572Help
Entry
CLUG_00572        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
Organism
clu  Clavispora lusitaniae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 342 aa AA seqDB search
MEQASQPPGAQKKKLSRDTTTKGKYSLNDFQILRTLGTGSFGRVHLARSVHNGRFYAMKT
LKKERVVQMKQVEHTNDERRMLKLAQHPFIIRMWGTFQDCNNLFMIMDYIEGGELFSLLR
KSQRFPTPVAKFYAAEVFLAIEYLHSFDIIYRDLKPENILLDKNGHIKLTDFGFAKEVED
VTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENILNG
TITYPDYLQPDILDLLQKLIVKDLTQRLGNLQNGSDDVKNHPWFKEVVWERLLSRDIETP
YEPPITSGVGDTSQFDRYPEDKDLDYGITGVPDPYADKFVDF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagccagccagccgccgggggcacagaaaaaaaaactttccagagacacaacc
accaaaggcaaatactcgttaaatgactttcagattctcagaacgttgggcacagggtcg
tttgggcgggtgcacttggcccgttcggtccacaacgggcggttctacgccatgaagacg
ttgaagaaggagcgggttgtccagatgaaacaggtggaacacacaaacgacgaacggcga
atgttgaagttggcgcagcatccgttcatcatccgcatgtggggcacgttccaggactgc
aacaacttgttcatgatcatggactacatcgagggaggcgagttgttcctgttgttgaga
aagtcccagcggttcccaacgcccgtggccaagttctacgcggccgaggtgtttttggcc
atcgagtacttgcatagcttcgacatcatctaccgggatttgaagcccgaaaacattttg
ttggacaagaacggccacatcaagttgacggactttggttttgccaaagaggtggaggac
gtgacatacaccctttgcggcacgcccgattacattgcgcccgaggttgtagccacgaaa
ccatacaacaagtccgtggactggtggtcgtttgggattttgatctttgagatgctcaca
ggttacacgccgttttacgacccgacgccgatgaaaacgtatgaaaacatcttgaacggc
accatcacgtaccccgactacttgcagccggacattttggacttgctccagaagctcatt
gtcaaggatttgacgcaacgacttggcaatttgcaaaacggctctgacgacgtgaaaaac
catccgtggttcaaggaagtggtgtgggaaaggctcctttcgcgcgacattgaaacgccg
tacgagcctcccatcacctccggagtcggtgacacttctcagtttgaccgctatccggaa
gataaagacttggactatggaatcaccggagtgccagatccatacgcagacaaatttgtg
gatttctag

DBGET integrated database retrieval system