KEGG   Clavispora lusitaniae: CLUG_00597Help
Entry
CLUG_00597        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K14674  
TAG lipase / steryl ester hydrolase / phospholipase A2 / LPA acyltransferase [EC:3.1.1.3 3.1.1.13 3.1.1.4 2.3.1.51]
Organism
clu  Clavispora lusitaniae
Pathway
Steroid biosynthesis
Glycerolipid metabolism
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CLUG_00597
   00561 Glycerolipid metabolism
    CLUG_00597
   00564 Glycerophospholipid metabolism
    CLUG_00597
   00565 Ether lipid metabolism
    CLUG_00597
   00590 Arachidonic acid metabolism
    CLUG_00597
   00591 Linoleic acid metabolism
    CLUG_00597
   00592 alpha-Linolenic acid metabolism
    CLUG_00597
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     CLUG_00597
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     CLUG_00597
    3.1.1.4  phospholipase A2
     CLUG_00597
    3.1.1.13  sterol esterase
     CLUG_00597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 839 aa AA seqDB search
MDSRTDRADIPADIIEHLFTQHPQLRPAAAVPRPGLCARAQALARALPILGRLAPAPDSK
QALIDQLLAQQQNATTYRQWYDASAQLDELSGNNLWKATPQCRHYDHRLVQKNLEEMRSA
RLRKDHKLLLYLIRTKWTRNVGNMGALGLYRHSHVGTKRLVEEYIEECRQCLHYLVHDPS
VHLNDRYLLGMLIQTRKNIGRTALVLSGGSTFSLSHVGVLVALLENSLVPRIISGSSSGS
IIASILCCHTNDEIGELLMGITERRFTIFGTESEKDGRLKVFLQRIGHLLKFGTFFDISG
LRQTMYDFVGNITFREAYNRTGKILNVTVSPATKHEQTRLLNYLTAPNCLVWSAICASCS
LPGIFPSNSIYEKNPSTNKIHEWNNDESSKYVDGSVDGDLPILRLSEMFNVDHIIAVQVN
PHVSPILKVSVSSVGGKADSELSETVKGLLNNAYDFITSEIIHALQILHEMNIYQNLTLK
LISLLSQSYSGDITILPQLELRDFLKVFQNPTPQFMLDFILKGAKAAWPKITVINNHCGV
EFALDKEISFVRGRLIAEANSRIAQGFTDFPKAFDSNDYLVSSPVLAEEANAVSPAKQRA
KAKIRRHNSVTSGEARWQRHSPVVHRKRNSVSFVDRNLSFRGKSTTSLNSMGGKERESER
ESPFFKTPQAKYISNGGDGDSQSTRGTSFDFRSPHHEKYLDTDYVPASPKSEPREPRDKA
NLPRVSRAGSLRNSYVGLNRIKNSGEGDSPLSSPKSLEKAYLELEKNFKNLQPATLRQHF
KKPKEEKRLSFYLEKGGDMNGKQKSDEQKNDEQNNGQKKWTESCIRCGSRNQEKWNNNK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggactctcgcacagaccgggcggatattccagcggacattatcgagcaccttttcacg
cagcacccccagttgcgccctgcggcagccgttcctcgccccggattatgtgcgcgcgcg
caagctttggcgcgggccttgcccattttggggcggcttgcgcccgcgcccgacctgaaa
caggcgctcatcgaccaactcttggcccagcagcagaacgcaaccacttatcgccaatgg
tacgacgccagtgcccagctcgacgagctttcaggcaacaacctctggaaagccacgccg
cagtgccggcactacgaccaccgcttagtgcaaaaaaacctcgaagaaatgcgctcggcc
cgcctcaggaaagaccataagcttcttctctacctcattcgcaccaagtggacacgaaac
gtcggaaacatgggtgccttgggcctctaccgccattcgcatgtgggaacaaaacgtctc
gtggaagaatatatcgaagagtgtcgccaatgcttgcactatttggtccatgatccaagc
gtccacctaaacgaccggtaccttctaggcatgcttatccagacacgcaagaacattggc
cgcactgccttggttctctcgggaggatcgactttttcgctctcgcatgtcggcgttttg
gtggccctattggaaaacagtttggtgccgcgcatcatcagcggatcgtcatcggggtcc
atcatcgccagcattttgtgctgccacacaaacgacgaaattggcgagttgcttatggga
attacagaacggcgcttcaccattttcggcaccgagtccgagaaagatggcaggctcaaa
gttttcctccaacgcatcggccacctcctcaagttcggcacgtttttcgacatttccggc
ttgcgccagaccatgtatgattttgtgggaaacatcaccttccgcgaggcgtacaatcgg
acggggaaaatccttaatgtgacggtgtctcccgcaaccaagcacgaacagacccggctt
ctaaactatttaacagcgccaaactgtcttgtgtggtcagctatttgtgcttcgtgcctg
ttaccagggatattcccatccaactccatttacgagaagaaccccagcaccaacaagatc
cacgagtggaataacgacgagtcttcgaaatacgttgatgggtcagtggacggcgacttg
cccatcttgcgtctttctgaaatgttcaatgtggaccatatcattgccgtgcaagtaaat
ccgcatgtttcgcccatcttgaaagtatctgtttccagtgtgggaggaaaagccgatagt
gagctcagtgaaactgtaaaaggtctcttgaacaatgcctacgattttataaccagcgaa
atcattcatgcattgcagattctccatgagatgaacatctatcaaaatttgacactaaaa
ttgatttcgcttctttctcagctgtactcgggcgatatcaccatccttccccaacttgag
ttgcgtgatttcctcaaggtgtttcaaaacccaactcctcagtttatgctcgacttcatc
ctcaagggcgccaaagctgcatggcccaagattaccgtgatcaacaatcattgcggtgtg
gagtttgctctcgataaagagatctcgtttgttcggggtcgtttgattgcagaagccaat
agcagaatagctcagggctttactgattttccgaaagctttcgactcaaatgactatctt
gtcagttctcctgtgctagccgaagaagccaatgcagttagtcctgcaaagcaacgagcg
aaggcaaaaataaggagacacaatctggtcactagtggtgaggctcgttggcaacgacat
agtcctgtggtgcaccggaaaagaaactctgtcagttttgttgaccgaaacttgagtttc
cgaggcaaatccacaacgtccttgaattccatgggaggcaaagaaagggagtcagaaagg
gagtcaccgtttttcaagactccgcaagccaagtatatctctaacgggggtgatggcgat
agccaaagcacaagaggcacatctttcgacttccgcagtccgcatcatgagaagtacttg
gacacagattatgtaccagcttcaccgaaatcagagcctcgagagccccgtgataaagcc
aatctcccacgtgttctgcgagcaggctcgcttcggaactcgtatgttggactcaacagg
atcaaaaattcgggagaaggcgattctcctctcagctcacctaaaagtttagaaaaggcg
taccttgagcttgaaaagaacttcaaaaatctccaaccagcgacattgagacagcatttt
aaaaagccaaaggaggagaaaagactatcattttatttggaaaagggaggagatatgaat
ggcaagcagaaaagtgacgagcagaaaaatgacgagcagaataatggacagaaaaaatgg
acagagtcttgcatccgatgcggtagcagaaaccaagaaaaatggaacaacaacaaatga

DBGET integrated database retrieval system