KEGG   Clavispora lusitaniae: CLUG_00611Help
Entry
CLUG_00611        CDS       T01149                                 

Definition
similar to acetyl-coenzyme A synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
clu  Clavispora lusitaniae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLUG_00611
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_00611
   00620 Pyruvate metabolism
    CLUG_00611
   00640 Propanoate metabolism
    CLUG_00611
  Energy metabolism
   00680 Methane metabolism
    CLUG_00611
Enzymes [BR:clu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CLUG_00611
Lipid biosynthesis proteins [BR:clu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CLUG_00611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 672 aa AA seqDB search
MPEHLAMDHEGAQQPPQGFFDRSHSAPNLSSLDEYNAMYKQSIDDPATFFGNQARDLLSW
STPFNVARYPASPKDDFANGDIPAWFLGGQLNACYNAVDRWAFEDPNKPAIIYEGDEPGT
GRIISYGELLKDVCKLAQALVKAGVKKGDTVAVYLPMIPEAIVTLLAIVRIGAVHSVVFA
GFSSTSLRDRIVDADSRIVITADESKRGGKTIETKKIVDEALKDLPQVRNVFVFKRTGNK
HVPFYPGRDLWWHDELAKHGNYSPPVAVDSEDPLFLLYTSGSTGKPKGVQHNVAGYLLGA
LLTTKYTFDVHRDDIIFTAGDIGWITGHTYVVYGPLLNGATTVVFEGTPAYPDYSRYWQI
VDEYKVNQFYVAPTALRLLKRAGPSFIEKFKLDSLRVLGSVGEPIAGEVWHWYNEHIGRG
KAHIVDTYWQTESGSHLLTPLAGVTPTKPGSASLPFFGIDAHVLDPVTGKRLTEDGVEGV
LAIKNAWPSIARGIFNDYNRFIDTYLGNYKGYYFTGDGAARDKDGFYWILGRVDDVVNVS
GHRLSTAEIEAALIEHEMVGESAVVGYADDLTGQAVAAYVSLKSQFKSDDKDAIDAIKKE
LILTVRKEIGPFAAPKLILLVNDLPKTRSGKIMRRILRKVLAGEEDQLGDTSTLSDPSVV
QQIIDVVKETRK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacatttggccatggatcacgagggggcccagcagcccccacaaggtttcttt
gacagatcccactccgctcccaacttgagctctttggacgagtacaatgccatgtacaag
cagtccattgacgacccggccacgttttttggcaaccaggcccgcgatctcttgtcgtgg
agcacgcctttcaacgtcgcccgctacccggcgtcgcccaaggacgactttgccaacggc
gacattccagcgtggtttctcggcggccagttgaatgcgtgctacaacgcagtcgaccgc
tgggccttcgaggacccaaacaagcccgccatcatctacgaaggtgacgagcccggaaca
ggccgcatcatctcctacggcgagttgttgaaggacgtgtgcaagttggcccaggcgttg
gtcaaggccggcgtgaaaaagggcgacaccgttgccgtgtacttgcccatgattcccgag
gccattgtcaccttgttggccattgtgcgtatcggtgccgtgcactcggtggtgtttgct
ggcttttcgctgacctcgttgcgtgaccgtattgtggacgccgactcgcgcatcgttatc
accgccgacgagagcaagcgtggtggaaagaccattgaaacaaagaaaatcgttgacgag
gccctcaaggacttgccccaggtgcgcaatgtgtttgtgttcaagcgtacgggaaacaaa
catgtgcccttctatccgggccgtgacttgtggtggcacgatgagttggccaagcacggc
aactactctcccccagtcgctgtcgactccgaggacccattgtttttgttgtacacatcc
ggctccacaggtaaaccaaagggtgtgcagcacaatgtcgccggttatttgcttggtgcg
ttactcacaaccaagtacactttcgacgtgcaccgtgatgacatcatcttcactgccggt
gatattggatggatcacgggccacacatacgtggtctacggtcctttgctcaacggtgcc
accacagttgtattcgaaggcactccagcttacccagactactcgcggtactggcagatt
gttgacgagtacaaggttaaccagttctacgtggcgccaaccgcgttgcgtttgttgaag
cgggctggcccctccttcatcgaaaagttcaagttggactccttgcgtgtgttgggttct
gtcggtgaacctattgcaggagaggtgtggcactggtacaacgagcacattggccgtggc
aaggctcatattgtggatacctactggcaaaccgagtctggctctcacttgttgaccccg
ttggctggtgtaacccctaccaaacccggttccgcgtccttaccattctttggtattgac
gcccatgtgttggatcctgtcacgggtaagcgcttgactgaggatggcgtggaaggtgtt
ttggccatcaagaacgcctggccttcgatcgcacgtggtattttcaacgactacaaccgg
tttatcgacacttaccttggcaactacaaaggctactatttcacgggcgatggcgcagca
agagacaaggacggcttttactggatcttgggccgtgtcgatgatgtggtcaatgtgtct
ggtcacagattgtctactgcagagattgaggcggcgttgatcgagcacgaaatggttggt
gaaagtgctgttgttggatacgcagacgacttaacgggccaggctgtggctgcgtacgtg
tcgttgaagtctcagttcaagtctgatgacaaggacgcgatcgacgccatcaagaaggag
ttgatcttgactgtcagaaaggaaattggacctttcgctgcgccaaagttgattttgttg
gtgaacgacttgccaaagacgagatcgggcaagatcatgagaagaatcttgcgtaaggtt
ttggccggcgaggaggaccagttgggtgacacctcgacattgtccgaccctagtgttgtg
caacagatcatcgacgttgtcaaggaaacaagaaagtga

DBGET integrated database retrieval system