KEGG   Clavispora lusitaniae: CLUG_00611Help
Entry
CLUG_00611        CDS       T01149                                 

Definition
similar to acetyl-coenzyme A synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
clu  Clavispora lusitaniae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:clu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:clu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:clu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:clu00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 672 aa AA seqDB search
MPEHLAMDHEGAQQPPQGFFDRSHSAPNLSSLDEYNAMYKQSIDDPATFFGNQARDLLSW
STPFNVARYPASPKDDFANGDIPAWFLGGQLNACYNAVDRWAFEDPNKPAIIYEGDEPGT
GRIISYGELLKDVCKLAQALVKAGVKKGDTVAVYLPMIPEAIVTLLAIVRIGAVHSVVFA
GFSSTSLRDRIVDADSRIVITADESKRGGKTIETKKIVDEALKDLPQVRNVFVFKRTGNK
HVPFYPGRDLWWHDELAKHGNYSPPVAVDSEDPLFLLYTSGSTGKPKGVQHNVAGYLLGA
LLTTKYTFDVHRDDIIFTAGDIGWITGHTYVVYGPLLNGATTVVFEGTPAYPDYSRYWQI
VDEYKVNQFYVAPTALRLLKRAGPSFIEKFKLDSLRVLGSVGEPIAGEVWHWYNEHIGRG
KAHIVDTYWQTESGSHLLTPLAGVTPTKPGSASLPFFGIDAHVLDPVTGKRLTEDGVEGV
LAIKNAWPSIARGIFNDYNRFIDTYLGNYKGYYFTGDGAARDKDGFYWILGRVDDVVNVS
GHRLSTAEIEAALIEHEMVGESAVVGYADDLTGQAVAAYVSLKSQFKSDDKDAIDAIKKE
LILTVRKEIGPFAAPKLILLVNDLPKTRSGKIMRRILRKVLAGEEDQLGDTSTLSDPSVV
QQIIDVVKETRK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacatttggccatggatcacgagggggcccagcagcccccacaaggtttcttt
gacagatcccactccgctcccaacttgagctctttggacgagtacaatgccatgtacaag
cagtccattgacgacccggccacgttttttggcaaccaggcccgcgatctcttgtcgtgg
agcacgcctttcaacgtcgcccgctacccggcgtcgcccaaggacgactttgccaacggc
gacattccagcgtggtttctcggcggccagttgaatgcgtgctacaacgcagtcgaccgc
tgggccttcgaggacccaaacaagcccgccatcatctacgaaggtgacgagcccggaaca
ggccgcatcatctcctacggcgagttgttgaaggacgtgtgcaagttggcccaggcgttg
gtcaaggccggcgtgaaaaagggcgacaccgttgccgtgtacttgcccatgattcccgag
gccattgtcaccttgttggccattgtgcgtatcggtgccgtgcactcggtggtgtttgct
ggcttttcgctgacctcgttgcgtgaccgtattgtggacgccgactcgcgcatcgttatc
accgccgacgagagcaagcgtggtggaaagaccattgaaacaaagaaaatcgttgacgag
gccctcaaggacttgccccaggtgcgcaatgtgtttgtgttcaagcgtacgggaaacaaa
catgtgcccttctatccgggccgtgacttgtggtggcacgatgagttggccaagcacggc
aactactctcccccagtcgctgtcgactccgaggacccattgtttttgttgtacacatcc
ggctccacaggtaaaccaaagggtgtgcagcacaatgtcgccggttatttgcttggtgcg
ttactcacaaccaagtacactttcgacgtgcaccgtgatgacatcatcttcactgccggt
gatattggatggatcacgggccacacatacgtggtctacggtcctttgctcaacggtgcc
accacagttgtattcgaaggcactccagcttacccagactactcgcggtactggcagatt
gttgacgagtacaaggttaaccagttctacgtggcgccaaccgcgttgcgtttgttgaag
cgggctggcccctccttcatcgaaaagttcaagttggactccttgcgtgtgttgggttct
gtcggtgaacctattgcaggagaggtgtggcactggtacaacgagcacattggccgtggc
aaggctcatattgtggatacctactggcaaaccgagtctggctctcacttgttgaccccg
ttggctggtgtaacccctaccaaacccggttccgcgtccttaccattctttggtattgac
gcccatgtgttggatcctgtcacgggtaagcgcttgactgaggatggcgtggaaggtgtt
ttggccatcaagaacgcctggccttcgatcgcacgtggtattttcaacgactacaaccgg
tttatcgacacttaccttggcaactacaaaggctactatttcacgggcgatggcgcagca
agagacaaggacggcttttactggatcttgggccgtgtcgatgatgtggtcaatgtgtct
ggtcacagattgtctactgcagagattgaggcggcgttgatcgagcacgaaatggttggt
gaaagtgctgttgttggatacgcagacgacttaacgggccaggctgtggctgcgtacgtg
tcgttgaagtctcagttcaagtctgatgacaaggacgcgatcgacgccatcaagaaggag
ttgatcttgactgtcagaaaggaaattggacctttcgctgcgccaaagttgattttgttg
gtgaacgacttgccaaagacgagatcgggcaagatcatgagaagaatcttgcgtaaggtt
ttggccggcgaggaggaccagttgggtgacacctcgacattgtccgaccctagtgttgtg
caacagatcatcgacgttgtcaaggaaacaagaaagtga

DBGET integrated database retrieval system