KEGG   Clavispora lusitaniae: CLUG_00707Help
Entry
CLUG_00707        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
clu  Clavispora lusitaniae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 174 aa AA seqDB search
MGLASSKVLDSLMDGTNFDREEIDRLRKRFMKLDSDGSGTIDKNEFLAIPGISSNPLAQR
LMDVFDEDNDGTIDFQEFITGLSAFSGKTSRDEKLRFAFKIYDIDQDGFIATGELFIVMK
MMVGKNLSDAELQQVVDKTIMENDRDGDNKLSFEEFRNAVDSTSVANVLTLNDF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggggttggcgtcatctaaagtgttagattccctaatggatggaacaaattttgaccgt
gaagaaatcgatcgtttgcggaaacggtttatgaaacttgacagcgatggtagcggaacg
attgacaagaatgagtttttggctattccgggaattctgtcgaacccattggcgcaaaga
cttatggatgtgtttgacgaggacaacgatggtactattgatttccaggaatttattact
ggactttctgcgttcagtgggaaaacatccagagacgagaaactaaggtttgcgttcaag
atttacgacattgatcaggacggatttattgccacaggcgaattgttcattgttatgaag
atgatggttggcaaaaatctactggatgcagagcttcagcaggtggtggacaagacgatt
atggaaaacgatcgcgatggtgataataagttgagtttcgaggagttccgcaatgcggtg
gatctgacactggtagccaatgttttgacgttaaacgacttttag

DBGET integrated database retrieval system