KEGG   Clavispora lusitaniae: CLUG_00713Help
Entry
CLUG_00713        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CLUG_00713
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   CLUG_00713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MLNMLLLNIEPADDKGPRYIRADHYKKVSFGFRIMSNLSPSFNTRFASIGIATDADAARP
PKKPAKKSYPASLYPENYHRETATTPSRAPVLSTAKRAVSRHSNPLKQINSSSTATKRHL
NRPLAESADPETQSPCKSKPRKAPDLSSCSFMKETSSSRNRQALAEKQARQAERSSIQTR
AASHSEIYNRRPGHLGTKKRLFPKSAKSTDLASLATKNANVPEHTSPRHVSTAYTNRDKE
DVYARLYNNALRSKTRLDKSRNTSNRRPSSRSRSPNCPSIPLEATMFDGSRSMDSRKPWT
VNDVYQIIFAADPSIFNETNSSDFSIPPVAGTDPRQLLDSTEGAALSIFERGELMRKSNV
YYLPNLGSGRDESSINISSFKNNYGFDDLEGNYVIHQGDHIEYRYEILRILGTGSFGNVV
LCADRKYQNHVDSRKVAIKIIKNELDWSLQAVSEIKLLKSLNTPPHASQYIMNYCDHFHF
RGHMCIVSEVLSLNLYTFLELTSFSGVRLALLRKFARDILRGLSFIHDTHIIHCDIKPEN
IMIKLPPYYDPNQTSISDFLVKIIDFGSSCYENETSYSYIQSRFYRAPEVILGAQYGSEI
DVWSFGCVIAELFSGTPLLPGKSELEQMGLILEMFGAPSCTHIINERKRLMRQVKIARSK
GLSDPLVSDPSSLLSKGKPPVDERKIKKTLLYSLFNLEGKLNLKFLNTQLQSVSHKTSAP
SPFKRTIKPNSKSIEVALRLHSSHEDRNDISHFSKFLHSIFRFERETRATATELLGHVFL
NE
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatgcttctcctaaacattgaacctgcagatgacaagggacccaggtacata
cgcgcagatcactacaagaaggtgtcatttgggttccggattatgtctaatctctcgcct
agcttcaacactcgttttgctagcattgggattgccacagatgcagacgccgcccggccg
ccaaagaaaccagcgaaaaagctgtatccggcgagcttgtatccggaaaactaccatcgt
gaaactgccacaactccttcacgggcgcctgttctttcgacagcgaaaagggccgtctcc
agacactcgaatcctctcaagcaaattaactcgagctccacggccacaaagcgccacttg
aatcgtcccttggccgaatctgccgatcctgaaacccaatctccatgtaaatccaagcct
cggaaagctcctgacctactgctgtgttccttcatgaaagaaacgtcttcgtcacggaac
agacaggctctagcagaaaagcaggctagacaagctgaaaggagtctgatccagaccaga
gccgcatcccactcagaaatatataataggcgtccaggacatctaggaacaaagaaacgt
ctttttccgaaatcagcaaaatcaactgaccttgcatcgctagcaaccaaaaatgcaaat
gttcctgaacatacttccccacggcatgtgtctacagcatacaccaatcgcgataaagaa
gacgtttacgcccggctttataacaatgcgttgaggctgaaaacaagattggataaatca
cgcaacacgtcaaaccgtaggccatcttccagaagtcgatcgcccaactgtccctctata
cctttagaggcaacaatgtttgatggatccagaagtatggatagcagaaaaccgtggaca
gtcaatgacgtataccaaatcatatttgcggcagacccgctgatttttaacgaaacgaac
tctctggatttctctataccccctgtggcaggtacggacccacgccagttgttggattca
acggaaggcgctgctctcagtatattcgagcgcggtgaattaatgcgcaagtctaatgta
tactatcttccaaatcttggaagtggaagggacgaaagctctataaacatcagcagcttc
aagaacaactacgggttcgatgatttagaaggcaattacgttatacaccagggtgatcac
attgaatatcgttacgaaatcttgcggattctagggactggatctttcggaaatgttgtt
ctctgcgctgatagaaagtatcagaatcatgtcgacagtcgcaaagtggccatcaaaatc
ataaaaaacgaattagattggtcattgcaagctgtaagtgaaatcaaactactcaagagt
ttgaatacaccaccacatgcgtctcaatatatcatgaactattgtgatcattttcatttt
cgtgggcacatgtgtatcgttagtgaagtgctttcattgaatctctacacatttttggag
ctcacatcatttagcggagttcggctagcattactacgcaaatttgcacgagacatattg
cgtggactaagcttcattcatgacacgcatattattcattgtgatataaaaccggaaaat
atcatgattaagcttccaccatattatgaccctaaccagaccagcatatctgatttcctt
gttaaaatcatcgacttcggttcctcctgttatgagaacgaaacatcatattcgtacatc
caatccagattttacagagcaccagaggttattctcggtgcacaatatggctcagaaatt
gatgtatggtcctttggttgcgttattgccgaattattttccggcactccacttcttccc
gggaagtcggaattggagcagatgggtcttattttagagatgtttggtgctccatcatgt
actcacatcatcaacgaacgtaagcgacttatgaggcaagttaaaatagcacgctcaaaa
ggattaagtgatccgcttgtttcagatccctcgctgttgctttcaaaagggaaacctcca
gttgacgaaaggaaaatcaaaaagacccttctctactcacttttcaatcttgagggaaag
ctaaatctcaagtttctcaacacacagcttcaatcggtttcacacaagacaagcgcgccg
agtccattcaagcgcaccatcaaacccaattctaaaagcatagaagtggctttaaggctc
cactcatcgcatgaggaccgcaacgacatcagccacttctccaaatttttgcatagtata
tttaggttcgagagagagacgagggccactgccacagaacttctaggccatgtctttctc
aacgaatag

DBGET integrated database retrieval system