KEGG   Clavispora lusitaniae: CLUG_00713Help
Entry
CLUG_00713        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
clu  Clavispora lusitaniae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MLNMLLLNIEPADDKGPRYIRADHYKKVSFGFRIMSNLSPSFNTRFASIGIATDADAARP
PKKPAKKSYPASLYPENYHRETATTPSRAPVLSTAKRAVSRHSNPLKQINSSSTATKRHL
NRPLAESADPETQSPCKSKPRKAPDLSSCSFMKETSSSRNRQALAEKQARQAERSSIQTR
AASHSEIYNRRPGHLGTKKRLFPKSAKSTDLASLATKNANVPEHTSPRHVSTAYTNRDKE
DVYARLYNNALRSKTRLDKSRNTSNRRPSSRSRSPNCPSIPLEATMFDGSRSMDSRKPWT
VNDVYQIIFAADPSIFNETNSSDFSIPPVAGTDPRQLLDSTEGAALSIFERGELMRKSNV
YYLPNLGSGRDESSINISSFKNNYGFDDLEGNYVIHQGDHIEYRYEILRILGTGSFGNVV
LCADRKYQNHVDSRKVAIKIIKNELDWSLQAVSEIKLLKSLNTPPHASQYIMNYCDHFHF
RGHMCIVSEVLSLNLYTFLELTSFSGVRLALLRKFARDILRGLSFIHDTHIIHCDIKPEN
IMIKLPPYYDPNQTSISDFLVKIIDFGSSCYENETSYSYIQSRFYRAPEVILGAQYGSEI
DVWSFGCVIAELFSGTPLLPGKSELEQMGLILEMFGAPSCTHIINERKRLMRQVKIARSK
GLSDPLVSDPSSLLSKGKPPVDERKIKKTLLYSLFNLEGKLNLKFLNTQLQSVSHKTSAP
SPFKRTIKPNSKSIEVALRLHSSHEDRNDISHFSKFLHSIFRFERETRATATELLGHVFL
NE
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatgcttctcctaaacattgaacctgcagatgacaagggacccaggtacata
cgcgcagatcactacaagaaggtgtcatttgggttccggattatgtctaatctctcgcct
agcttcaacactcgttttgctagcattgggattgccacagatgcagacgccgcccggccg
ccaaagaaaccagcgaaaaagctgtatccggcgagcttgtatccggaaaactaccatcgt
gaaactgccacaactccttcacgggcgcctgttctttcgacagcgaaaagggccgtctcc
agacactcgaatcctctcaagcaaattaactcgagctccacggccacaaagcgccacttg
aatcgtcccttggccgaatctgccgatcctgaaacccaatctccatgtaaatccaagcct
cggaaagctcctgacctactgctgtgttccttcatgaaagaaacgtcttcgtcacggaac
agacaggctctagcagaaaagcaggctagacaagctgaaaggagtctgatccagaccaga
gccgcatcccactcagaaatatataataggcgtccaggacatctaggaacaaagaaacgt
ctttttccgaaatcagcaaaatcaactgaccttgcatcgctagcaaccaaaaatgcaaat
gttcctgaacatacttccccacggcatgtgtctacagcatacaccaatcgcgataaagaa
gacgtttacgcccggctttataacaatgcgttgaggctgaaaacaagattggataaatca
cgcaacacgtcaaaccgtaggccatcttccagaagtcgatcgcccaactgtccctctata
cctttagaggcaacaatgtttgatggatccagaagtatggatagcagaaaaccgtggaca
gtcaatgacgtataccaaatcatatttgcggcagacccgctgatttttaacgaaacgaac
tctctggatttctctataccccctgtggcaggtacggacccacgccagttgttggattca
acggaaggcgctgctctcagtatattcgagcgcggtgaattaatgcgcaagtctaatgta
tactatcttccaaatcttggaagtggaagggacgaaagctctataaacatcagcagcttc
aagaacaactacgggttcgatgatttagaaggcaattacgttatacaccagggtgatcac
attgaatatcgttacgaaatcttgcggattctagggactggatctttcggaaatgttgtt
ctctgcgctgatagaaagtatcagaatcatgtcgacagtcgcaaagtggccatcaaaatc
ataaaaaacgaattagattggtcattgcaagctgtaagtgaaatcaaactactcaagagt
ttgaatacaccaccacatgcgtctcaatatatcatgaactattgtgatcattttcatttt
cgtgggcacatgtgtatcgttagtgaagtgctttcattgaatctctacacatttttggag
ctcacatcatttagcggagttcggctagcattactacgcaaatttgcacgagacatattg
cgtggactaagcttcattcatgacacgcatattattcattgtgatataaaaccggaaaat
atcatgattaagcttccaccatattatgaccctaaccagaccagcatatctgatttcctt
gttaaaatcatcgacttcggttcctcctgttatgagaacgaaacatcatattcgtacatc
caatccagattttacagagcaccagaggttattctcggtgcacaatatggctcagaaatt
gatgtatggtcctttggttgcgttattgccgaattattttccggcactccacttcttccc
gggaagtcggaattggagcagatgggtcttattttagagatgtttggtgctccatcatgt
actcacatcatcaacgaacgtaagcgacttatgaggcaagttaaaatagcacgctcaaaa
ggattaagtgatccgcttgtttcagatccctcgctgttgctttcaaaagggaaacctcca
gttgacgaaaggaaaatcaaaaagacccttctctactcacttttcaatcttgagggaaag
ctaaatctcaagtttctcaacacacagcttcaatcggtttcacacaagacaagcgcgccg
agtccattcaagcgcaccatcaaacccaattctaaaagcatagaagtggctttaaggctc
cactcatcgcatgaggaccgcaacgacatcagccacttctccaaatttttgcatagtata
tttaggttcgagagagagacgagggccactgccacagaacttctaggccatgtctttctc
aacgaatag

DBGET integrated database retrieval system