KEGG   Clavispora lusitaniae: CLUG_00805Help
Entry
CLUG_00805        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CLUG_00805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 679 aa AA seqDB search
MLDTLDIAVITALALAVAYYFGKDYIVSSDPHSSGFLADDGSENDRDLSSTLKKNNKNAV
VFYASQTGTAEDYAHKLSKELTSKFGLRVLIADTADYDYDNVQNLDPDYLFFFVVATYGE
GEPTDNAVEFFNWLENEADQLANVKYTVFGLGNSTYEFYNAMGQKLNEKLESLGAERIAP
YGQGDDGIGTMDEDFLAWKESCFDALKTNLSLEERESVYEPSFKLTEDDSLSSSDAGVSN
GEPNKAYVDFTKDLTKGPFDHTHPYLAPITKTKELFNSKDRHCVHAEFDISGSNLRYTTG
DHLAIWPSNSNENVAQFLKCFGLAEKADTVFSLKALDSTVALPFPTPITYEAVVRHHLEI
SGPISRQAFASIAPFAPNEDAKKECLRLGGDKLVFAEEIHGKYLNLADALLSISKGLPWT
SVPFVFLIELIPSLQPRYYSISSSSMSEKTSIHVTAVVEAEEHDGHLVTGVATNLLKDIE
VHQNHSDDKTYASYDLNGPKNKFSNYKLPVHVRRSTFKLPSNPSTPIILVGPGTGLAPMR
GFIREKVKLLETSSNAPLGKILLFYGCRNKNEDFLYKDEWPEYSKVLGENFELDVAFSRE
DPNKKVYVQHKILARAKEINALLEKGAFIYVCGDASRMARDVQSTFVEILASERGISTER
AAELVRSFKVQNRYQEDVW
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgttggatacgttggatattgcggtcatcactgccttggcgctagctgtggcctactat
tttggaaaagactatatagtttcgtctgacccccattcatctggctttctcgcagacgat
ggcagcgaaaatgatagagatctcagttccactttgaagaagaacaacaaaaacgctgtt
gttttttacgcatcccagacgggaactgccgaggactatgcccacaaattgtccaaggag
ttgacttcgaaattcggtttgagagtcttgattgcagatacagcagactatgactacgac
aatgttcagaatttggacccagactatcttttcttctttgtggttgcaacatacggcgag
ggagagccaactgacaatgcagtggagtttttcaactggttggagaatgaggcggaccaa
ttggccaatgttaagtacacggtgttcggtttgggcaactcaacgtatgagttctacaat
gccatgggccaaaaattgaacgagaagctcgaatcccttggagcagagcgcattgctcca
tatggccaaggcgacgacggaattggaactatggatgaggactttcttgcttggaaagaa
agttgttttgacgctttgaagaccaacttgagccttgaagaacgtgaactggtttacgaa
ccttctttcaagcttactgaagatgatagtttatccagctcagatgctggagtttcgaat
ggtgagccaaacaaagcatatgtcgattttaccaaagatttgacaaagggtccatttgac
cacacacatccataccttgctcctatcacgaagactaaagaattgtttaactcaaaggat
agacactgtgttcatgcagagtttgatatttcaggctccaacttaaggtacactacaggt
gaccatttagcgatctggccgtccaactctaatgaaaatgttgctcaattcttaaaatgt
tttggcttggcagaaaaggcagacactgttttctctttgaaggctttggactctactgtg
gcgcttcctttcccaactccaattacctatgaagcagttgtgagacaccatttggaaatc
tcaggtcccatttccagacaagcctttgcatctattgctccattcgctccaaatgaagac
gccaagaaggaatgtttgagattgggcggagacaagttggtttttgctgaggaaattcat
ggcaaatatctcaatttggctgatgctcttttgtcaatctctaaaggtcttccctggact
agtgttccattcgtctttttgatagagctcattcctagcttgcaacctcgttactactcc
atctcctcctcatccatgagcgaaaagacctcgatccatgttaccgctgttgtcgaagcc
gaggaacacgatggccatcttgtcactggtgtggccacaaatttgttgaaggacattgaa
gttcatcaaaaccactcggatgacaagacatatgcatcctacgacttgaatggcccaaag
aacaaatttagcaactataaacttccagtccatgttcggagatcaacatttaagttgcca
tccaatccaagtaccccaattattttagtgggtcctggaacaggtcttgcacctatgaga
ggttttatcagagagaaggttaagttactcgagacgtcactgaacgcccctcttggtaag
attttattattctacggttgcagaaacaaaaacgaggatttcctttacaaggatgaatgg
ccagaatactcaaaagtgcttggagagaactttgagttggacgtggccttttcacgtgaa
gaccccaataaaaaggtctatgttcaacacaaaatcttggcaagagctaaggagatcaac
gcacttttggaaaaaggtgcattcatctatgtttgcggtgatgcatcgagaatggccaga
gacgtccagtccacgtttgttgaaattcttgctagtgaaagaggcatttccactgagaga
gcggccgagttggtcagatctttcaaggtgcaaaatagataccaggaagatgtgtggtag

DBGET integrated database retrieval system