KEGG   Clavispora lusitaniae: CLUG_00984Help
Entry
CLUG_00984        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clu  Clavispora lusitaniae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:clu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:clu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:clu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:clu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:clu00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 943 aa AA seqDB search
MAIPLVSGPSGAILLAPEKPLMAQTISFYSQLTGFSVVAQTDSSATLAGKDGASLRIELG
DTKSADQIAESISRWSTELQTRDWRSVAPHLTLCVSEFSELVSRLQSFKYPVQLYPNDLY
PTEAYTVDPLGHVVGFTTAKNPMSINPPVEKFTHGHEIAPSMSTTVSEKRATAPGATQRR
NIAVMTSGGDAPGMNACVRAVVRAAIFRGCRAFAVMEGYEGLVRGGPENIREMSWQDVRG
FLSEGGTNIGTARCMAFKERAGRLAGCKHMVEAGIDALIVCGGDGSLTGADLFRSEWPSL
IEELREKKEITAEQYEKHKHLNICGTVGSIDNDMATTDATIGAYSSLDRICKAVDYIDAT
ANSHSRAFVIEVMGRHCGWLALMAGIACSADYILIPEKPSSSKDWQDQMCDIVSKHRAKG
KRKTIVIVAEGAITNDLAPISAKEVKDVLVDRLHLDTRVTTLGHVQRGGTAVAYDRVLAT
LQGVEAVKAVLESTPETPSPLIGITENKIVRLSLVDAVRITKSVASAIESKDFAKAMSMR
DSEFVEHLHNFMAINSANHEEPTLPQEKRKRIAIINVGAPAGGMNSAVYAMATYCMSRGH
TPYAIHNGFSGLARHESVRSIDWLTIEGWTSVGGSEIGTNRATPQDTDIGMIAYYFEKYQ
FDGLILVGGFEAFASLDQLEKARSMYPSFRIPMVLIPATISNNVPGTEYSLGSDTCLNSL
MEYCDVVKQSASATRDRAFVIEVQGGNSGYIATYASLACGAQASYVPEEGIDLAQLELDV
RHLKEAFATEKGMSKSGKLILKSTNASKVLTAEVLANIMKSEANGEFDAKTAIPGHVQQG
GLPSPIDRTRGTRFAVKAVQFIENVYDDIAPYHDALDFPIDDKKVINTAAVLGIKSSHLT
FSSIRQLYDFETETESRMPKKISWSTVRDICDQLVGRTKLAAK
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggctatccctttagttagcggcccttccggcgccattttgcttgcaccggaaaagccg
ttgatggctcagaccatcagcttctactcgcaattgacgggtttttccgtcgttgcccaa
accgactcgagcgcaactttggctgggaaagacggcgccagccttagaatcgaactcggt
gataccaaactggcagaccaaattgcagaatcgatttcccgttggtctaccgagcttcag
acccgcgattggcgttccgtggcaccccacttaaccttatgcgtttctgagttcctggaa
ttagtctcccgtttgcaaagcttcaagtacccggtgcagctctacccaaacgacttgtat
ccaactgaagcatacaccgtcgaccctttgggccacgtggttggcttcaccactgctaag
aacccaatgtccattaatcctccagttgagaaattcactcacggccatgaaattgcccct
ctgatgtccactactgtactggagaaaagagccactgctccaggcgcgacccagcgccgt
aatatcgctgtcatgacctctggtggagatgctccgggaatgaacgcatgtgttcgtgct
gtcgtccgggccgctattttccgtggctgcagagcgttcgccgtgatggaaggttacgaa
gggttggtgcgtggtggccccgagaacattcgtgaaatgagctggcaggatgtgcgtggc
ttcttgtctgaaggtggtacaaacattggtactgcgcggtgcatggcattcaaagagcgg
gcgggtcgtttggccggatgtaaacacatggtcgaagccggaatcgacgctcttattgtc
tgtggtggtgacggttctttgaccggtgccgatttgttccgttctgagtggccctctctc
atcgaggagttgagggagaagaaggagattactgcggagcaatacgaaaaacacaagcac
ttgaacatttgcggtactgtgggatcgatcgacaatgatatggccaccactgatgcaacc
attggtgcatactcatcgttggaccgtatctgtaaagctgtggactatattgatgccacc
gcaaactctcactcccgtgcttttgtcattgaggttatgggccgtcattgcggttggttg
gcattgatggctggtattgcctgcagcgctgattacattttgattccagagaaacccctg
tcttctaaagactggcaagatcaaatgtgcgacattgtgtcaaagcaccgtgctaaggga
aagcggaagaccattgtcattgtggctgaaggtgccatcacaaacgacttggccccaatt
agtgcgaaagaagtgaaggatgtcttggtggaccgtttgcacttggatacacgtgtcact
actttgggccatgtgcaacgtggtggtactgctgtggcttacgacagagtgttggccaca
ttgcaaggtgttgaagccgtgaaggctgtcttggagtcaactccagaaacgccgtcgcct
ttgattggtatcactgaaaacaagattgtccgcttgtcgttagtggatgctgtccgtatc
accaagtctgtggctctggctatcgagtccaaggactttgctaaggccatgtctatgcgt
gactcggaatttgttgagcatttgcacaatttcatggcaattaactccgccaaccatgaa
gagccaacgctcccacaagaaaagcgcaagcgcattgccatcatcaatgtcggtgctcca
gcgggtggtatgaatagtgctgtgtatgccatggccacctactgcatgtcgcgtggacac
acgccgtacgctattcacaacggtttctccggtttggcccgtcatgaatctgtgcgttca
attgattggttgaccattgaaggctggacctctgttggtggttccgaaattggtaccaac
agagctacccctcaggatactgatataggcatgatcgcttactactttgagaaataccag
ttcgatggtttgattcttgttggtggttttgaggcgtttgcatccttggaccagttggag
aaagcgcgttccatgtatccaagcttccgtattccaatggtcttgatcccggcgactatc
tccaacaatgttccaggtactgagtactcgttgggctccgacacgtgtttgaactccttg
atggagtactgtgatgttgtcaagcagtctgcatctgccaccagagaccgtgcattcgtg
attgaagtccagggtggtaactcgggctacattgctacatatgcctctttggcatgtggt
gcccaggcgtcctatgttcctgaagagggcattgatttggcccaacttgagctcgatgtc
agacatttgaaagaagcgtttgctacggagaaaggaatgtctaagagcggtaagttgatt
ttgaaaagtaccaacgcctctaaagtgttgacagccgaggttttggctaacatcatgaag
ctggaggccaatggtgagttcgatgccaagactgccattccaggccacgtgcaacaaggt
ggcttgccttcgcctatagacagaactagaggtactagatttgctgtcaaggcagtccaa
ttcattgaaaatgtgtacgatgacattgctccataccatgatgcgcttgatttcccaatt
gatgacaagaaggtcataaatactgccgctgtcttgggaatcaaatcgtctcacttgacc
ttctcctccattagacagttatacgactttgagactgagaccgaaagcagaatgccaaag
aaaatttcgtggtctactgtgagagatatttgtgaccagttggtgggcagaactaagctt
gccgcaaagtaa

DBGET integrated database retrieval system