KEGG   Clavispora lusitaniae: CLUG_00984Help
Entry
CLUG_00984        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clu  Clavispora lusitaniae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLUG_00984
   01230 Biosynthesis of amino acids
    CLUG_00984
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_00984
   00030 Pentose phosphate pathway
    CLUG_00984
   00051 Fructose and mannose metabolism
    CLUG_00984
   00052 Galactose metabolism
    CLUG_00984
  Energy metabolism
   00680 Methane metabolism
    CLUG_00984
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLUG_00984
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLUG_00984
Protein phosphatases and associated proteins [BR:clu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLUG_00984
Messenger RNA biogenesis [BR:clu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLUG_00984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 943 aa AA seqDB search
MAIPLVSGPSGAILLAPEKPLMAQTISFYSQLTGFSVVAQTDSSATLAGKDGASLRIELG
DTKSADQIAESISRWSTELQTRDWRSVAPHLTLCVSEFSELVSRLQSFKYPVQLYPNDLY
PTEAYTVDPLGHVVGFTTAKNPMSINPPVEKFTHGHEIAPSMSTTVSEKRATAPGATQRR
NIAVMTSGGDAPGMNACVRAVVRAAIFRGCRAFAVMEGYEGLVRGGPENIREMSWQDVRG
FLSEGGTNIGTARCMAFKERAGRLAGCKHMVEAGIDALIVCGGDGSLTGADLFRSEWPSL
IEELREKKEITAEQYEKHKHLNICGTVGSIDNDMATTDATIGAYSSLDRICKAVDYIDAT
ANSHSRAFVIEVMGRHCGWLALMAGIACSADYILIPEKPSSSKDWQDQMCDIVSKHRAKG
KRKTIVIVAEGAITNDLAPISAKEVKDVLVDRLHLDTRVTTLGHVQRGGTAVAYDRVLAT
LQGVEAVKAVLESTPETPSPLIGITENKIVRLSLVDAVRITKSVASAIESKDFAKAMSMR
DSEFVEHLHNFMAINSANHEEPTLPQEKRKRIAIINVGAPAGGMNSAVYAMATYCMSRGH
TPYAIHNGFSGLARHESVRSIDWLTIEGWTSVGGSEIGTNRATPQDTDIGMIAYYFEKYQ
FDGLILVGGFEAFASLDQLEKARSMYPSFRIPMVLIPATISNNVPGTEYSLGSDTCLNSL
MEYCDVVKQSASATRDRAFVIEVQGGNSGYIATYASLACGAQASYVPEEGIDLAQLELDV
RHLKEAFATEKGMSKSGKLILKSTNASKVLTAEVLANIMKSEANGEFDAKTAIPGHVQQG
GLPSPIDRTRGTRFAVKAVQFIENVYDDIAPYHDALDFPIDDKKVINTAAVLGIKSSHLT
FSSIRQLYDFETETESRMPKKISWSTVRDICDQLVGRTKLAAK
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggctatccctttagttagcggcccttccggcgccattttgcttgcaccggaaaagccg
ttgatggctcagaccatcagcttctactcgcaattgacgggtttttccgtcgttgcccaa
accgactcgagcgcaactttggctgggaaagacggcgccagccttagaatcgaactcggt
gataccaaactggcagaccaaattgcagaatcgatttcccgttggtctaccgagcttcag
acccgcgattggcgttccgtggcaccccacttaaccttatgcgtttctgagttcctggaa
ttagtctcccgtttgcaaagcttcaagtacccggtgcagctctacccaaacgacttgtat
ccaactgaagcatacaccgtcgaccctttgggccacgtggttggcttcaccactgctaag
aacccaatgtccattaatcctccagttgagaaattcactcacggccatgaaattgcccct
ctgatgtccactactgtactggagaaaagagccactgctccaggcgcgacccagcgccgt
aatatcgctgtcatgacctctggtggagatgctccgggaatgaacgcatgtgttcgtgct
gtcgtccgggccgctattttccgtggctgcagagcgttcgccgtgatggaaggttacgaa
gggttggtgcgtggtggccccgagaacattcgtgaaatgagctggcaggatgtgcgtggc
ttcttgtctgaaggtggtacaaacattggtactgcgcggtgcatggcattcaaagagcgg
gcgggtcgtttggccggatgtaaacacatggtcgaagccggaatcgacgctcttattgtc
tgtggtggtgacggttctttgaccggtgccgatttgttccgttctgagtggccctctctc
atcgaggagttgagggagaagaaggagattactgcggagcaatacgaaaaacacaagcac
ttgaacatttgcggtactgtgggatcgatcgacaatgatatggccaccactgatgcaacc
attggtgcatactcatcgttggaccgtatctgtaaagctgtggactatattgatgccacc
gcaaactctcactcccgtgcttttgtcattgaggttatgggccgtcattgcggttggttg
gcattgatggctggtattgcctgcagcgctgattacattttgattccagagaaacccctg
tcttctaaagactggcaagatcaaatgtgcgacattgtgtcaaagcaccgtgctaaggga
aagcggaagaccattgtcattgtggctgaaggtgccatcacaaacgacttggccccaatt
agtgcgaaagaagtgaaggatgtcttggtggaccgtttgcacttggatacacgtgtcact
actttgggccatgtgcaacgtggtggtactgctgtggcttacgacagagtgttggccaca
ttgcaaggtgttgaagccgtgaaggctgtcttggagtcaactccagaaacgccgtcgcct
ttgattggtatcactgaaaacaagattgtccgcttgtcgttagtggatgctgtccgtatc
accaagtctgtggctctggctatcgagtccaaggactttgctaaggccatgtctatgcgt
gactcggaatttgttgagcatttgcacaatttcatggcaattaactccgccaaccatgaa
gagccaacgctcccacaagaaaagcgcaagcgcattgccatcatcaatgtcggtgctcca
gcgggtggtatgaatagtgctgtgtatgccatggccacctactgcatgtcgcgtggacac
acgccgtacgctattcacaacggtttctccggtttggcccgtcatgaatctgtgcgttca
attgattggttgaccattgaaggctggacctctgttggtggttccgaaattggtaccaac
agagctacccctcaggatactgatataggcatgatcgcttactactttgagaaataccag
ttcgatggtttgattcttgttggtggttttgaggcgtttgcatccttggaccagttggag
aaagcgcgttccatgtatccaagcttccgtattccaatggtcttgatcccggcgactatc
tccaacaatgttccaggtactgagtactcgttgggctccgacacgtgtttgaactccttg
atggagtactgtgatgttgtcaagcagtctgcatctgccaccagagaccgtgcattcgtg
attgaagtccagggtggtaactcgggctacattgctacatatgcctctttggcatgtggt
gcccaggcgtcctatgttcctgaagagggcattgatttggcccaacttgagctcgatgtc
agacatttgaaagaagcgtttgctacggagaaaggaatgtctaagagcggtaagttgatt
ttgaaaagtaccaacgcctctaaagtgttgacagccgaggttttggctaacatcatgaag
ctggaggccaatggtgagttcgatgccaagactgccattccaggccacgtgcaacaaggt
ggcttgccttcgcctatagacagaactagaggtactagatttgctgtcaaggcagtccaa
ttcattgaaaatgtgtacgatgacattgctccataccatgatgcgcttgatttcccaatt
gatgacaagaaggtcataaatactgccgctgtcttgggaatcaaatcgtctcacttgacc
ttctcctccattagacagttatacgactttgagactgagaccgaaagcagaatgccaaag
aaaatttcgtggtctactgtgagagatatttgtgaccagttggtgggcagaactaagctt
gccgcaaagtaa

DBGET integrated database retrieval system