KEGG   Clavispora lusitaniae: CLUG_01096Help
Entry
CLUG_01096        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
clu  Clavispora lusitaniae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLUG_01096
   00670 One carbon pool by folate
    CLUG_01096
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CLUG_01096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 237 aa AA seqDB search
MFSCEPGRSLFISHGCLIISARVSSTWLHHIHMIKSLKPVTSVIVAALSPKYGIGAQGKL
PWRLKQEMKYFKDVTSAARAGSINAVVMGRKTWESIPKKFRPLPNRLNIVLSRSFSNEEK
DGVLYFNSIDSIMSNLAQSNYWYHDKPIDKIFIIGGAEIYNSVMKGDLVDNLLVTNIRYV
GNPEAEPVLDTFLDWDMSLWEQSNVSRIREFSDVEFEEGIIKEGDYEYEYTMWERRK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgttcagttgtgaacctggcagactgttgttcatactgcatggctgcctcataataagt
gcacgcgtctcttcaacatggttgcatcacatacatatgataaagtcgttgaagcctgtt
acgtccgtcattgttgcggctttactgcctaaatatggcatcggtgcacaaggaaagctt
ccgtggagattgaaacaggaaatgaaatactttaaggatgtcacctctgctgcaagagca
ggttcaatcaacgcggtggtgatgggcagaaaaacatgggaatctattcctaaaaagttc
agacctttgccaaatagactcaatattgttttatcgagatcgttttcgaatgaggaaaag
gatggcgttctctatttcaacagtatcgactccatcatgtctaacttggcccaaagcaat
tactggtaccatgataaacctatagacaaaatcttcattatcggaggagccgagatatat
aattcagtgatgaaaggggatttggttgataatttgttggttacgaacatcaggtatgtc
ggaaaccctgaggcggaaccagttttagacacatttttggactgggacatgtctttgtgg
gaacagagtaatgtctcccgtataagagaattcctggacgtcgaatttgaggagggaata
atcaaagagggtgactatgagtacgagtacacaatgtgggaaagacgtaaataa

DBGET integrated database retrieval system