KEGG   Clavispora lusitaniae: CLUG_01102Help
Entry
CLUG_01102        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CLUG_01102
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CLUG_01102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MGTGWELTKALREKIYQYATYPQTSVSIRQMVQFGPSPSPGSIFLASRFIVEELPIRLAL
KVKDLENSPMGLSEMPSTIKVKNWYAQSFEELTSLPKPHVDEKLHQMLFNSDSAQRLKGG
DRDFSGVAETSNLAQEQKSNPAVNNEFSDDGIVVRHSPSSWASSSSSASSSSQSSLASST
TSASSSVRSDSPTYGLTYFNPCPMNIVWPKEVYDYNKLVYDALTKIKKRHDATVATMAQG
VQEWKTEHKLVTVNSAIQTFLDRFYMSRIGIRMLIGQHIALNMSQASPTRQRLSTLINGS
NGNSNKNGKSNYVGVICTECNVSEIAEDAVETAKYICEEYYGLFEAPEVQLIAPQSSVSF
MYVPGHLIHMFFEVLKNSLRATIEFHTPRLKREMMAENPNLKEDDIDINDLTFPPIKVII
SEGSEDITIKISDEGGGIARSEIPLIWTYLYTTMDKTPTLDAEYNQTSFKAPMAGFGYGL
PISRLYAQYFGGDLKLISMEGYGTDVYIHLNKLSSSSEPLP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaggctgggagctaacaaaagctctaagagaaaaaatataccagtatgccacg
tatccacagacgtctgttagcattcgccagatggttcagtttggtccgtcgccgtcgcct
ggctccatttttttggcttcccgcttcatagtcgaagaactacctattcgtcttgcgttg
aaagtgaaggacctagaaaactctccgatgggccttctggaaatgccatccaccatcaaa
gtcaagaactggtacgcacagtccttcgaggaactcacatcattgcccaaaccacatgtg
gacgaaaaactccaccagatgttgttcaacagcgactccgcacagcggttgaaaggtgga
gacagagattttctgggtgtggctgaaacttctaacttggcacaagaacagaagtctaat
ccagccgtcaacaatgaattttctgatgatggcattgtagtgagacattctccgtcgtca
tgggcgtcatcttcttcatctgcatcctcttcttcacaatcgtctcttgcgtcttccact
acgtcagcttcttcttcagtgagatctgactctcccacctacggcttaacttacttcaat
ccttgtcccatgaacattgtttggcctaaggaagtctatgactacaataagttggtctac
gatgcactcacaaaaataaaaaaaagacacgatgccactgttgctacaatggcccaaggt
gttcaagaatggaaaacggaacataagttagtgacagtgaactcggccatccaaacattt
ttggatcgtttctatatgctgcggatcggcatccgtatgcttattggacagcatattgcc
ctcaacatgtcacaagcttctcctacaagacaacgtctactgactttgatcaatggctct
aatggcaatagcaacaaaaacggtaaaagcaattatgtgggagtcatttgcacagaatgc
aatgtcagtgaaattgctgaagacgctgtggagactgcaaaatatatttgtgaagaatac
tatggccttttcgaggcgcctgaggtgcagttgattgcaccacaactgctggtgagcttt
atgtatgtaccaggtcaccttatccacatgtttttcgaagttttgaaaaactcacttcgt
gctactattgaattccatacccctcgtctcaagcgggagatgatggccgaaaacccaaat
ctcaaagaagatgatatcgatatcaacgatttgacatttccacctataaaagtcatcatc
agcgagggctcagaagacattactattaagatctccgacgaaggtggtggtatagcacgg
agtgagattccattaatttggacctatttgtataccacgatggataagacacctactttg
gatgcagagtacaatcagaccagttttaaggcaccaatggcaggatttgggtacggctta
ccaatatcacggctttatgcccagtattttggaggtgacttgaagcttatctctatggaa
ggctatggtactgatgtgtacattcacttgaacaagttgagtagttcactggaaccgctt
ccttaa

DBGET integrated database retrieval system