KEGG   Clavispora lusitaniae: CLUG_01322Help
Entry
CLUG_01322        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
clu  Clavispora lusitaniae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 403 aa AA seqDB search
MGRKVFLVFSSVGCQLSDLVPANKGRQSLVDSLIIAYDLHSKCEIISVANADSSDLTAYH
SPQYVAKLLEVRSDDFSDEEEEAIERLKNTLGVTCDANSIRTADSDKENTQLDHVGDDMY
GLEYDTPVFPFMNEYVKFVAGSSLSAARCLLTCVNSRRISINWYGGRHHCFKNRASGFCY
VNDVVLAILKLRQKFKKVAYVDLDLHHGDGVERAFQFSHNVTTCSVHMHDIGFYPGTGGL
KSSRRGMYNIPLKRGLKDETMVQVVRDFVCPLIKAGDPEVIVLQLGCDGLVSDPSGQWNL
TIRGYWSAVELILKCFPNVSFLVLGGGGYDHTEAAKCWAYITKMIIGDESEWTEIPDHDH
QEDYSRDSFQFWTVKNQEPKVGRKDENTPEYLQMLKNSLDIFM
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgggacgaaaggtctttttagtgttttcttccgtcggctgccaattaagtgacttggtt
ccagcgaataaaggtcgacagtccttggttgactcattgataatagcatatgatttgcat
tcgaagtgtgagataatctctgttgctaatgctgattcatcagatctcaccgcgtatcat
tcaccacaatatgtggccaaattgctagaagtcagatctgatgacttttctgatgaagaa
gaagaagcaatagaaaggctcaagaatactcttggtgtaacatgtgatgctaacagtatt
cgaacagcagatagtgataaagaaaatactcagcttgatcatgttggcgacgatatgtac
ggcctcgagtatgacacgcctgtatttcctttcatgaatgaatatgttaagttcgtggct
ggatcctcacttagtgcagctcgctgtcttcttacatgcgttaactctcgaaggatatct
atcaattggtatgggggaagacatcactgcttcaagaatcgggcttctggtttctgttat
gtcaacgatgttgtattggccattttgaagctacgccaaaagttcaagaaagttgcatac
gtggatctagatttgcatcatggcgacggagtagaacgtgcctttcaattctctcacaac
gtcaccacttgctctgttcacatgcatgatatcggcttctacccaggaactgggggctta
aaaagttcacgaagaggaatgtataacattcccctaaaacggggtctaaaagatgagact
atggtacaagtagtccgagatttcgtctgtcctttaatcaaagcaggggatccagaagta
atagtactacagcttggttgtgacggattagtttcagatcctctggggcaatggaattta
accattcggggttattggctggccgttgagcttattttgaaatgcttcccaaatgtgtcc
tttttagtgttgggaggcggaggttatgatcatactgaagccgccaagtgctgggcttat
atcactaaaatgataatcggtgacgaatcggaatggacggaaattcctgaccatgaccat
caagaagattactctcgtgatagcttccaattttggacagttaaaaaccaggaaccgaaa
gtcgggcgaaaggatgaaaacaccccagagtacctacaaatgcttaagaatctgttggat
atattcatgtga

DBGET integrated database retrieval system