KEGG   Clavispora lusitaniae: CLUG_01383Help
Entry
CLUG_01383        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
clu  Clavispora lusitaniae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLUG_01383
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLUG_01383
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLUG_01383
Enzymes [BR:clu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLUG_01383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 701 aa AA seqDB search
MSASLRETFARCKKEGRNALVNFITAGYPTIEDTVPIMLGMQEGGVDIIELGVPFSDPIA
DGPTIQVANNVAIDNGVTVVKCLELVAQAREAGVSVPIILMGYFNPIMKYGEEKLVEDAA
KAGASGFIVVDLPPEEAVEFRSTCAKHGLSYVPLVAPATTDARLAVLGDIADSFIYVVSR
MGTTGSNTAVSSGIATLCDRVRKFVGDKPLAVGFGVSTREHFLTVGAAAEGVVIGSKIVT
LLGESAPGERREVAFRFVRSILGEDFSRAELPPFAPYAPPANASVPKPLLQESHQYSPRF
GAFGGQYVPEALHTCLAELEKGFESAVADPQFWSEFKALYPYIGRPSSFHKAERLSAHAG
GAQIWLKREDLNHTGSHKINNALAQVLIARRLGKKRIIAETGAGQHGVATATACAKFGME
CCVFMGAEDVKRQALNVFRMRILGAKVVAVTNGTQTLRDATSEAFRYWVSHLESTHYVVG
SAIGPHPYPTLVRTFQSVIGQEAKEQFQELSGGRLPDAVVACVGGGSNSTGLFSPFEKDT
SVRMVGIEAGGDGVNTDRHSATLTAGIPGVFHGVKTYVLQDADGQVHDTHSVSAGLDYPG
VGPELAYWKSTGRAEFSAVTDAQALEGFRLLSQLEGIIPALESSHAIYGGVELAKTMKPD
QHIIINVSGRGDKDVQSVAKALPVLGEQIGWDLRFEDDPSK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttccttaagagagacatttgcaagatgcaaaaaggagggcagaaacgccctc
gtcaactttatcacagccggctaccctactatcgaagacacagttcccatcatgcttggc
atgcaggaaggtggtgtcgacatcatcgagttgggtgttcccttctccgacccgatcgcc
gacggccctactatccaggtggccaataacgttgccatagacaacggtgtcactgttgtc
aaatgcttggagttggtggcgcaggccagagaagctggtgtttctgttcccatcatcttg
atgggttacttcaacccaatcatgaagtacggcgaggaaaaattggtggaggacgctgcc
aaggccggtgccagcggtttcattgtggtggacttgccgcctgaagaggctgttgagttc
agaagcacatgtgccaaacatggtctctcatacgttcctttggttgcgccagcaactacc
gatgcccgtttagcggtgttgggcgatatcgctgacctgttcatttacgtggtctcgcgt
atgggcaccaccggttccaacactgctgtttccagtggcattgccactttatgtgaccgt
gtgcgtaaatttgtcggcgataagcccttggccgttggttttggtgtgtcgacccgtgaa
catttcttgactgtgggtgccgccgccgaaggtgtggtgattggctcgaagatcgtgacg
cttttgggcgagtctgctcccggtgagcgtcgtgaagtggcgttccgctttgtccgttcc
atcttaggagaggacttttctcgcgccgagcttccgccatttgccccttatgccccacct
gcgaatgcttctgttcccaagccgctcttgcaagagagccaccagtacagtccacgtttc
ggtgcttttggtggccagtatgtacctgaagctttgcacacctgcttggccgagttagaa
aaaggcttcgagagtgccgttgctgatccacagttctggtcagaattcaaagctttgtat
ccttacattggaaggccatcttctttccacaaggctgaacgcttgtctgcgcacgctggg
ggtgcccaaatctggttgaaacgtgaggacttgaaccacaccggctcgcacaagatcaac
aacgccttggcccaggttttgatcgcacgtcgtttgggcaagaaacgcattattgccgag
acaggtgctggccagcacggtgtagctactgctactgcatgtgccaagtttggcatggag
tgctgtgtctttatgggtgctgaagacgtgaagcgccaagcgttgaacgttttccgtatg
cgtattttgggagctaaagttgttgctgtgacaaacggaacacaaactcttcgtgacgcc
acgtcggaagccttccgttactgggtgtcccacctagagtccacacattatgtcgtggga
ctggccattggacctcatccgtaccctacattggtgcgtaccttccaaagtgttattggc
caggaggcaaaagagcaattccaggagttgtcaggtggccgcttacctgatgccgttgtg
gcttgtgtgggtggtggttctaattccaccggtttgttctctcctttcgaaaaggacact
tctgtgcgtatggttggaattgaggctggtggtgacggtgtcaacaccgaccgccactct
gctactttgactgccggtattccaggtgttttccacggtgttaaaacgtacgttttacag
gacgctgatggccaggtccatgacactcactctgtatctgcaggcttggactacccaggt
gttggacctgagttggcttattggaagagtacgggccgtgctgagtttagcgctgtcact
gatgcgcaggctttggaaggtttcagattgttgtcgcagttggaaggtatcattccggct
ttggaatcttcccatgccatttacggaggtgttgagcttgccaagaccatgaagcctgac
cagcacattattatcaatgtttccgggcgtggtgacaaagatgtgcaaagtgttgctaag
gccttaccagttttgggcgagcaaattggctgggacttacgtttcgaggacgatccttca
aagtaa

DBGET integrated database retrieval system