KEGG   Clavispora lusitaniae: CLUG_01383Help
Entry
CLUG_01383        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
clu  Clavispora lusitaniae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLUG_01383
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLUG_01383
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLUG_01383
Enzymes [BR:clu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLUG_01383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 701 aa AA seqDB search
MSASLRETFARCKKEGRNALVNFITAGYPTIEDTVPIMLGMQEGGVDIIELGVPFSDPIA
DGPTIQVANNVAIDNGVTVVKCLELVAQAREAGVSVPIILMGYFNPIMKYGEEKLVEDAA
KAGASGFIVVDLPPEEAVEFRSTCAKHGLSYVPLVAPATTDARLAVLGDIADSFIYVVSR
MGTTGSNTAVSSGIATLCDRVRKFVGDKPLAVGFGVSTREHFLTVGAAAEGVVIGSKIVT
LLGESAPGERREVAFRFVRSILGEDFSRAELPPFAPYAPPANASVPKPLLQESHQYSPRF
GAFGGQYVPEALHTCLAELEKGFESAVADPQFWSEFKALYPYIGRPSSFHKAERLSAHAG
GAQIWLKREDLNHTGSHKINNALAQVLIARRLGKKRIIAETGAGQHGVATATACAKFGME
CCVFMGAEDVKRQALNVFRMRILGAKVVAVTNGTQTLRDATSEAFRYWVSHLESTHYVVG
SAIGPHPYPTLVRTFQSVIGQEAKEQFQELSGGRLPDAVVACVGGGSNSTGLFSPFEKDT
SVRMVGIEAGGDGVNTDRHSATLTAGIPGVFHGVKTYVLQDADGQVHDTHSVSAGLDYPG
VGPELAYWKSTGRAEFSAVTDAQALEGFRLLSQLEGIIPALESSHAIYGGVELAKTMKPD
QHIIINVSGRGDKDVQSVAKALPVLGEQIGWDLRFEDDPSK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttccttaagagagacatttgcaagatgcaaaaaggagggcagaaacgccctc
gtcaactttatcacagccggctaccctactatcgaagacacagttcccatcatgcttggc
atgcaggaaggtggtgtcgacatcatcgagttgggtgttcccttctccgacccgatcgcc
gacggccctactatccaggtggccaataacgttgccatagacaacggtgtcactgttgtc
aaatgcttggagttggtggcgcaggccagagaagctggtgtttctgttcccatcatcttg
atgggttacttcaacccaatcatgaagtacggcgaggaaaaattggtggaggacgctgcc
aaggccggtgccagcggtttcattgtggtggacttgccgcctgaagaggctgttgagttc
agaagcacatgtgccaaacatggtctctcatacgttcctttggttgcgccagcaactacc
gatgcccgtttagcggtgttgggcgatatcgctgacctgttcatttacgtggtctcgcgt
atgggcaccaccggttccaacactgctgtttccagtggcattgccactttatgtgaccgt
gtgcgtaaatttgtcggcgataagcccttggccgttggttttggtgtgtcgacccgtgaa
catttcttgactgtgggtgccgccgccgaaggtgtggtgattggctcgaagatcgtgacg
cttttgggcgagtctgctcccggtgagcgtcgtgaagtggcgttccgctttgtccgttcc
atcttaggagaggacttttctcgcgccgagcttccgccatttgccccttatgccccacct
gcgaatgcttctgttcccaagccgctcttgcaagagagccaccagtacagtccacgtttc
ggtgcttttggtggccagtatgtacctgaagctttgcacacctgcttggccgagttagaa
aaaggcttcgagagtgccgttgctgatccacagttctggtcagaattcaaagctttgtat
ccttacattggaaggccatcttctttccacaaggctgaacgcttgtctgcgcacgctggg
ggtgcccaaatctggttgaaacgtgaggacttgaaccacaccggctcgcacaagatcaac
aacgccttggcccaggttttgatcgcacgtcgtttgggcaagaaacgcattattgccgag
acaggtgctggccagcacggtgtagctactgctactgcatgtgccaagtttggcatggag
tgctgtgtctttatgggtgctgaagacgtgaagcgccaagcgttgaacgttttccgtatg
cgtattttgggagctaaagttgttgctgtgacaaacggaacacaaactcttcgtgacgcc
acgtcggaagccttccgttactgggtgtcccacctagagtccacacattatgtcgtggga
ctggccattggacctcatccgtaccctacattggtgcgtaccttccaaagtgttattggc
caggaggcaaaagagcaattccaggagttgtcaggtggccgcttacctgatgccgttgtg
gcttgtgtgggtggtggttctaattccaccggtttgttctctcctttcgaaaaggacact
tctgtgcgtatggttggaattgaggctggtggtgacggtgtcaacaccgaccgccactct
gctactttgactgccggtattccaggtgttttccacggtgttaaaacgtacgttttacag
gacgctgatggccaggtccatgacactcactctgtatctgcaggcttggactacccaggt
gttggacctgagttggcttattggaagagtacgggccgtgctgagtttagcgctgtcact
gatgcgcaggctttggaaggtttcagattgttgtcgcagttggaaggtatcattccggct
ttggaatcttcccatgccatttacggaggtgttgagcttgccaagaccatgaagcctgac
cagcacattattatcaatgtttccgggcgtggtgacaaagatgtgcaaagtgttgctaag
gccttaccagttttgggcgagcaaattggctgggacttacgtttcgaggacgatccttca
aagtaa

DBGET integrated database retrieval system